KEGG   Corynebacterium pseudotuberculosis 1002: Cp1002_2100Help
Entry
Cp1002_2100       CDS       T01876                                 

Gene name
trxB
Definition
(GenBank) Thioredoxin reductase
  KO
K00384  thioredoxin reductase (NADPH) [EC:1.8.1.9]
Organism
cpk  Corynebacterium pseudotuberculosis 1002
Pathway
cpk00450  Selenocompound metabolism
Brite
KEGG Orthology (KO) [BR:cpk00001]
 Metabolism
  Metabolism of other amino acids
   00450 Selenocompound metabolism
    Cp1002_2100 (trxB)
Enzymes [BR:cpk01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.9  thioredoxin-disulfide reductase
     Cp1002_2100 (trxB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox FAD_binding_2 HI0933_like DAO K_oxygenase Thi4 GIDA FAD_oxidored NAD_binding_8 NAD_binding_7 FAD_binding_3 Trp_halogenase
Motif
Other DBs
NCBI-ProteinID: ADL21955
Position
2325925..2326872
Genome map
AA seq 315 aa AA seqDB search
MSEAPNATTVHDVAIIGSGPAGYTAALYAARAELKPIVFEGIEFGGSLMTTTEVENFPGF
PEGIMGPDLMDNMRSQAERFGADLRMELVTKVELEGEIKKIWVDDQEFHARSVILATGSA
PRYIGAEGEQTLLGRGVSACATCDGFFFRDHDIAVIGGGDSAMEEATFLTKFAKSVTIVH
RREEFRASAIMLERAKNNDKIKFLTNNTVSKVLGENTVSGLELTDTATGETSILDVTAMF
VAIGHDPRSDLFRGVVDTNDAGYVRVEEPSTRTNVPGVFAVGDLVDAHYQQAITAAGSGC
RGAIDAENYLAALDA
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaagcacccaacgcgaccacagtgcacgacgtagccatcatcggttctggccca
gccggctatacagcagcactctatgcggctcgcgctgagctcaagcccattgttttcgag
ggaatcgaattcggtggttctctgatgaccaccacagaggtagaaaacttccctggtttt
ccagaaggcatcatggggccagacctcatggacaacatgcgctcccaagccgagcgtttt
ggggcagatctccgaatggagttggtaaccaaggtagagcttgaaggggagatcaagaag
atctgggtcgacgaccaagagttccacgctcgttccgtcatcttggccacaggttctgcg
cctcgctatatcggtgcagaaggcgaacaaacccttcttggtcggggcgtctctgcatgt
gccacatgtgatggattcttcttccgcgatcatgacatcgctgtcatcggcggcggcgat
tctgccatggaagaggcaacattcctcaccaagtttgctaaatctgtgaccatcgttcac
cgtcgcgaagaattccgtgcctctgccatcatgttggagcgagcaaaaaataacgacaag
atcaaattcctcaccaacaataccgtatccaaggtattgggggagaacactgtaagcggg
ctggagctcacagacactgccacaggagaaacctctattctcgatgtcacggcaatgttc
gtagccatcggccatgatcctcgctctgatttattccgcggagtagtggataccaatgat
gctggctatgttcgggtagaagagccttccactcgcaccaatgttcctggtgtctttgcc
gtaggagatcttgtcgacgctcactaccagcaggcaatcaccgccgcggggtccggttgt
cggggagctatagacgccgagaattatctcgcagccctcgatgcctaa

DBGET integrated database retrieval system