KEGG   Corynebacterium pseudotuberculosis 1002: Cp1002_2106Help
Entry
Cp1002_2106       CDS       T01876                                 

Gene name
gidB
Definition
(GenBank) Glucose-inhibited division protein B
  KO
K03501  16S rRNA (guanine527-N7)-methyltransferase [EC:2.1.1.170]
Organism
cpk  Corynebacterium pseudotuberculosis 1002
Brite
KEGG Orthology (KO) [BR:cpk00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:cpk03009]
    Cp1002_2106 (gidB)
   03036 Chromosome and associated proteins [BR:cpk03036]
    Cp1002_2106 (gidB)
Enzymes [BR:cpk01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.170  16S rRNA (guanine527-N7)-methyltransferase
     Cp1002_2106 (gidB)
Ribosome biogenesis [BR:cpk03009]
 Prokaryotic Type
  rRNA modification factors
   16S rRNA modification factors
    Cp1002_2106 (gidB)
Chromosome and associated proteins [BR:cpk03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    Cp1002_2106 (gidB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GidB MTS Methyltransf_4 Methyltransf_31 Methyltransf_16
Motif
Other DBs
NCBI-ProteinID: ADL21961
Position
complement(2331441..2332112)
Genome map
AA seq 223 aa AA seqDB search
MKHEENNGTEHGLELTPPPEIAAEIFGSLLDKAVEYHRLLATDGSTRGFIGPREIPKLWD
RHILNCAVIGEAMDSNARVADIGSGAGLPGIPLALARPDLEITLIEPLLKRSVFLGEVKD
SLGLDNVTIMRGRAEEKVIRNELGLVDVVTSRAVAPLGKLAGWSLPLVRLGGKMIAMKGS
SVKEELARDEKMIFKAGGGKIKIFTVGDQLEDPTTLISIRKVR
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacatgaggaaaataacggcaccgagcatgggcttgagctgacccctcctccggag
atagccgcagaaattttcggatctctgctggataaagcggtggaataccatcgtttattg
gctaccgatggctctacacgtggatttatcggtccccgcgaaatccctaaactatgggat
cgtcacatacttaattgtgcagttataggcgaagcgatggactccaatgctcgcgttgcg
gatattggttccggtgctggtttgccaggcatccctctcgcacttgctcgccccgatctg
gagataaccctcatagagccgttactcaaacgctctgtttttctgggggaagtgaaggat
tctctgggtctagataacgtgaccataatgaggggacgcgcagaggaaaaagtgattcga
aacgagctagggcttgttgacgtagtgacctcacgtgcagtggctccgctaggaaaactt
gcgggctggtcgcttcccctagttcgtcttggagggaaaatgatcgctatgaaaggatcc
tctgtaaaagaagagcttgcccgtgatgaaaaaatgatttttaaagctggcggcgggaaa
atcaagatttttacggtgggtgatcaacttgaagacccaactacgctgatttctatccga
aaagttcgctaa

DBGET integrated database retrieval system