KEGG   Corynebacterium pseudotuberculosis 1002: Cp1002_2109Help
Entry
Cp1002_2109       CDS       T01876                                 

Gene name
rnpA
Definition
(GenBank) Ribonuclease P protein component
  KO
K03536  ribonuclease P protein component [EC:3.1.26.5]
Organism
cpk  Corynebacterium pseudotuberculosis 1002
Brite
KEGG Orthology (KO) [BR:cpk00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cpk03016]
    Cp1002_2109 (rnpA)
Enzymes [BR:cpk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.5  ribonuclease P
     Cp1002_2109 (rnpA)
Transfer RNA biogenesis [BR:cpk03016]
 Prokaryotic Type
  5'processing factors
   Ribonucrease P
    Cp1002_2109 (rnpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribonuclease_P
Motif
Other DBs
NCBI-ProteinID: ADL21964
Position
complement(2333612..2333968)
Genome map
AA seq 118 aa AA seqDB search
MLPSRHKLSSSDEFRRTIRKGKRAGRSTVVIHLRTHATAGEIAAVGGPRFGLVVSKAVGN
AVTRHAVSRKLRHVLMGIKDQIPQDAHIVVRALPPAATATSKELESDVRSGVEKLLLR
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
gtgcttccttctaggcacaagctcagcagttccgacgagttccgtagaactattcggaaa
ggcaagcgtgctgggagaagcaccgtcgttattcatttacgcacccacgctactgcgggg
gaaatagcggcagtaggagggccgcgttttggcctcgtggtatctaaagccgtgggtaat
gcagtgacccgtcatgcagtttctcgcaaacttcgtcatgttcttatgggcatcaaagac
cagattcctcaagacgcacatatcgtcgtccgcgcattaccgccggcggcaacagcaacg
tctaaggagcttgagtcagatgttcgttcgggcgtcgaaaagcttcttttacgttga

DBGET integrated database retrieval system