KEGG   Corynebacterium pseudotuberculosis 3/99-5: Cp3995_0893Help
Entry
Cp3995_0893       CDS       T01689                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructo kinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
cpl  Corynebacterium pseudotuberculosis 3/99-5
Pathway
cpl00010  Glycolysis / Gluconeogenesis
cpl00030  Pentose phosphate pathway
cpl00051  Fructose and mannose metabolism
cpl00052  Galactose metabolism
cpl00680  Methane metabolism
cpl01100  Metabolic pathways
cpl01110  Biosynthesis of secondary metabolites
cpl01120  Microbial metabolism in diverse environments
cpl01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cpl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cp3995_0893 (pfkA)
   00030 Pentose phosphate pathway
    Cp3995_0893 (pfkA)
   00051 Fructose and mannose metabolism
    Cp3995_0893 (pfkA)
   00052 Galactose metabolism
    Cp3995_0893 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    Cp3995_0893 (pfkA)
Enzymes [BR:cpl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Cp3995_0893 (pfkA)
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Cp3995_0893 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: AEX39358
Position
933644..934672
Genome map
AA seq 342 aa AA seqDB search
MRIATLTSGGDCPGLNAVIRGIVRTCSEYGSTVVGYEDGWVGLMEDKRIQLYDDENIDRI
LLRGGTILGTGRLHPDKFKAGLEQIKENLADAEIDALIPIGGEGTLKGAQWLSDNGIPVV
GVPKTIDNDVNGTDYTFGFDTAVSVATDAIDRLHTTAESHNRVMIVEVMGRHVGWIALHA
GMAGGAHYTVIPEHPFDLNEICKAMERRFQMGEKYGIIVVAEGALPKEGTMSFAQGCVDQ
FGHQTFNGIGQVIGEEIKRRLGHDVRTTVLGHIQRGGTPTAYDRVLATRYGVHAARACHT
QDFGKMVALHGEHIDLIPLEEAVGTLKVVPAARYRTARALFG
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgcgaattgcgactttaacctctggcggcgattgccccggactcaacgctgtcatccgc
ggtatcgtccgcacctgttccgaatacggttctaccgttgtgggatatgaggacggttgg
gttggtcttatggaagacaagcgcattcaactttacgatgatgaaaatattgatcgtatt
cttttgcgcggcggaacgatcttgggaactggccgccttcaccccgataagttcaaggca
ggacttgagcaaatcaaagagaatttagcagacgccgaaattgatgctttgattccgatt
ggtggcgagggcacgctaaagggagcccaatggctttctgataatgggatccctgtggtg
ggcgtgcccaaaactatcgataatgatgtcaacggtaccgattacacctttggctttgac
accgcggtgtcggtagcaactgacgcaattgatcgtttacataccaccgcagaatcccac
aatcgcgtgatgatcgtggaagtgatggggcgtcatgtcgggtggatcgcattgcatgcg
gggatggcaggcggagcacactacactgtgattccagagcatccttttgatctcaatgag
atctgcaaagcgatggaacgccgtttccaaatgggggagaagtacggaattatcgtcgtt
gctgagggggctttgcctaaggaaggaacgatgagttttgcccaggggtgcgtagaccaa
tttgggcatcaaacctttaacggcatcggccaagtgatcggcgaagaaataaagaggcgc
ctaggtcacgacgtacgtactactgtgctcggacacatccaacgcggcggtactccgact
gcttatgatcgtgttttggcaacccggtatggtgttcacgctgcccgtgcttgccataca
caagactttggcaagatggtggcacttcatggtgagcatattgacctaattcctttggaa
gaagcagtaggaactttgaaggtagttcctgcggctagatatcggacagccagagctctc
tttggataa

DBGET integrated database retrieval system