KEGG   Corynebacterium pseudotuberculosis 3/99-5: Cp3995_0970Help
Entry
Cp3995_0970       CDS       T01689                                 

Gene name
argF
Definition
(GenBank) Ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
cpl  Corynebacterium pseudotuberculosis 3/99-5
Pathway
cpl00220  Arginine biosynthesis
cpl01100  Metabolic pathways
cpl01110  Biosynthesis of secondary metabolites
cpl01130  Biosynthesis of antibiotics
cpl01230  Biosynthesis of amino acids
Module
cpl_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:cpl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    Cp3995_0970 (argF)
Enzymes [BR:cpl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     Cp3995_0970 (argF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace OTCace_N
Motif
Other DBs
NCBI-ProteinID: AEX39434
Position
1023114..1024115
Genome map
AA seq 333 aa AA seqDB search
MNTSTAFSSFDAAGSGKALARHFLADDDLTPLEQCEVLELAAELKKHPYSLTPLEGPQSV
AVLFDKTSTRTRFSFDAGIAQLGGNAIVVDTNASQMGKGETYQDTGAVLSRFVSAIVWRT
FAHSNLMEMAQTATVPIINALSDDLHPCQILADLQTCIEHLCAEEGPKGLRGKKAVYLGD
GSNNMANSYIIGFATAGINISIIAPTDFHPKEEFVARAQRRAEQTGAMVTVTDDLNEASG
AHIVITDTWVSMGMEKDGIDRRTPFIPYQVNDAIMDRADENAIFLHCLPAYRGNEVTASV
IDGPQSVVFDEAENRLHAQKALMSWLLEHQPTA
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgaatacgagtacagccttttcctcctttgacgctgcaggatctgggaaggcattagcc
aggcatttcttggcagatgatgatctcacacctttagaacaatgcgaagtattagaactg
gctgcggagttaaagaagcacccgtattctttaactccgttggaaggaccacagtcggtt
gcggtcttatttgacaagacctccacgcggacgcgattttcttttgacgcaggaatcgca
cagctaggtggcaatgcgattgttgtagacacaaatgcctctcagatgggcaaaggggaa
acgtatcaagataccggagcagtcctttcccggtttgtatcggccattgtatggcgcacg
tttgctcattctaacctcatggaaatggctcagactgctactgtgcccattattaacgct
ttgtctgatgatcttcacccctgccaaattttggcagatctccaaacctgtatcgagcac
ctttgcgcagaagaagggccgaagggattgcgcgggaaaaaagctgtctatttgggggac
ggcagcaataatatggcgaactcttatattatcggttttgccacagcgggtataaatata
agcatcattgctccaacggattttcatcctaaggaagaatttgtagcccgagcacaaaga
cgtgctgagcaaaccggagcaatggtcaccgtaactgatgatcttaatgaagcatcagga
gcgcatatagtgattacagatacatgggtgtctatggggatggagaaagacggtattgat
cgtcgaaccccctttatcccttatcaagttaatgatgccattatggatcgtgctgatgag
aacgctatatttcttcattgtcttcctgcgtatcggggaaatgaagttactgcttctgtt
atcgatggcccgcagtctgtggtcttcgatgaggcggaaaatcgtctacacgcgcagaaa
gcacttatgtcttggctgctggaacaccagccgacagcctag

DBGET integrated database retrieval system