KEGG   Corynebacterium pseudotuberculosis 3/99-5: Cp3995_1234Help
Entry
Cp3995_1234       CDS       T01689                                 

Gene name
ppgK
Definition
(GenBank) Polyphosphate glucokinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
cpl  Corynebacterium pseudotuberculosis 3/99-5
Pathway
cpl00010  Glycolysis / Gluconeogenesis
cpl00520  Amino sugar and nucleotide sugar metabolism
cpl01100  Metabolic pathways
cpl01110  Biosynthesis of secondary metabolites
cpl01120  Microbial metabolism in diverse environments
cpl01130  Biosynthesis of antibiotics
cpl01200  Carbon metabolism
Module
cpl_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cpl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cp3995_1234 (ppgK)
   00520 Amino sugar and nucleotide sugar metabolism
    Cp3995_1234 (ppgK)
Enzymes [BR:cpl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     Cp3995_1234 (ppgK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: AEX39697
Position
1319348..1320100
Genome map
AA seq 250 aa AA seqDB search
MTRIGFGIDVGGSGIKGARVDLDTGDFVGDRIKILTPKPATPEAVAQTISRIVAEAEWEG
PVGITLPSVIRNQVALSAANIDQSWINVDVQKLFTKTLGGRNIAVLNDADAAGIAEVAFG
EDQARRGSAILLTLGTGIGSAFFINGVLFPNTELGHMIVEGKEAEHLASSAAKDRDELSY
SKWAKRVSKVLSEYERLFWPDVFIVGGGISRKADKWVPKLTIDTPVIPAKLRNTAGIVGA
AMAADQNIRP
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgacacgaattggctttggcattgatgttggcggatctgggattaaaggtgcccgcgtt
gatctggataccggtgattttgtcggagatcggatcaaaattttaacccccaagcctgcc
acccccgaagcggtcgcccaaacgatttctcgcattgttgcagaggccgaatgggaagga
cccgtcggaataacgctgccttccgtaatccggaatcaagtagcactttctgccgccaac
attgaccaatcatggatcaatgttgatgttcaaaaattatttaccaagaccctgggcggg
cgtaacatcgcagtgcttaacgacgccgatgcggcgggcatcgccgaggtagccttcgga
gaagatcaagctcgacgtggttccgccattttgctcactctaggcactgggatcggttcc
gctttctttatcaacggggtcttattccccaacaccgagttagggcacatgatcgtagag
ggaaaggaagccgagcatctagcttcatctgcagcaaaagatcgcgatgagttgagctat
tccaaatgggccaagcgcgtttctaaagtcctcagcgaatacgaacgacttttttggcca
gacgtttttatcgtaggcggtggtatctcacgcaaagctgataaatgggtacccaaactc
actatcgatacgcccgtcatacctgcaaaactacgtaataccgcaggtatcgtaggagca
gcaatggcggcagaccaaaatatcaggccttag

DBGET integrated database retrieval system