KEGG   Corynebacterium pseudotuberculosis 3/99-5: Cp3995_1326Help
Entry
Cp3995_1326       CDS       T01689                                 

Definition
(GenBank) Magnesium chelatase
  KO
K03404  magnesium chelatase subunit D [EC:6.6.1.1]
Organism
cpl  Corynebacterium pseudotuberculosis 3/99-5
Pathway
cpl00860  Porphyrin and chlorophyll metabolism
cpl01100  Metabolic pathways
cpl01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cpl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Cp3995_1326
Enzymes [BR:cpl01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Cp3995_1326
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_5 Mg_chelatase MCM Sigma54_activat AAA_3 AAA AAA_16 AAA_30 CPSF100_C
Motif
Other DBs
NCBI-ProteinID: AEX39787
Position
complement(1411087..1412169)
Genome map
AA seq 360 aa AA seqDB search
MGTCGRTLYPFSAVVGQERLRLALLLCAISPRIGGVVIRGEKGTAKTTTVRAFARLLGEA
PLVDLPIGATEDRVVGSLDMETVLTTGKARYNPGLLSQADGGVLYVDEVNLLADHLVDSL
LDAAATGQVTVERDGISYSSPANFVLVGTMNPEEGELRPQLLDRFGLAVDVMASKDTDVR
AEIMRRRLAFESAPQSFAQAWSHEDASTALQIQKAKQRVQQLQLSNVNLNRIAHLCAAFD
VDGMRADLVIARTALAHAAWRGASMVEDEDIRIAAELALPHRRRRDPFDEPGLDQEQLDQ
EMEKARDQHPDASDKAEEPQEEKEQHTLENKSSETQSEQPTSDGQEECATTGAPFRSTGA
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgggcacctgtggacgcacactatatcctttctctgcagtagtagggcaggagcgatta
agactggcattactcttatgcgcaatttctccgcgtattggtggtgtagttatccgcggg
gaaaagggaacagcgaagaccactacggtgcgagcttttgcgcgtttgctaggagaagcc
cctttagttgatctccctatcggtgccacagaggatcgagtcgtggggtccctggatatg
gagacagtcttgaccaccggaaaagctcgctataacccgggcttgcttagtcaagcagac
ggtggggtgttgtacgtcgatgaggtaaatctcctcgcagatcacctcgtcgattcgctc
ttagacgcggcggcaacggggcaagtaacagttgaacgggatggcatttcttattcttct
cctgccaactttgtgctcgtggggacaatgaacccagaagaaggcgagttgcggccgcaa
ttgcttgatcgtttcggattggctgttgacgttatggcgtccaaagacactgatgtacga
gcagaaataatgcggcgtcggcttgctttcgaatcagccccgcaatcttttgcacaagcg
tggtcccatgaggatgcatcgacggcgctgcaaatacagaaggcgaaacaacgagtgcag
cagttacaactttctaacgttaatctgaaccggatcgcacatttgtgtgcagcatttgac
gtggacggtatgagagctgatttggttatcgctcgaactgcgctagcacatgctgcctgg
cgcggagcttcaatggttgaagatgaggatatccggatagccgcagagttggccttgccg
catcgccgtcgcagagacccattcgatgagcctggcctagaccaggaacagctggatcaa
gaaatggaaaaagcccgggatcagcaccctgacgccagtgataaagcggaagagcctcaa
gaggaaaaagagcagcatacactagagaacaagtcttcggagactcaatctgagcagccc
accagtgacggtcaggaggaatgcgctactactggcgctccctttcgctccacgggtgct
taa

DBGET integrated database retrieval system