KEGG   Corynebacterium pseudotuberculosis 3/99-5: Cp3995_2154Help
Entry
Cp3995_2154       CDS       T01689                                 

Gene name
trpA
Definition
(GenBank) Tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cpl  Corynebacterium pseudotuberculosis 3/99-5
Pathway
cpl00260  Glycine, serine and threonine metabolism
cpl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cpl01100  Metabolic pathways
cpl01110  Biosynthesis of secondary metabolites
cpl01130  Biosynthesis of antibiotics
cpl01230  Biosynthesis of amino acids
Module
cpl_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cpl00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cp3995_2154 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cp3995_2154 (trpA)
Enzymes [BR:cpl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Cp3995_2154 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth ThiG NanE Amidohydro_2 IMPDH
Motif
Other DBs
NCBI-ProteinID: AEX40596
Position
2313324..2314163
Genome map
AA seq 279 aa AA seqDB search
MNRYHNLFTRLEQSNEGAFVPFIMLGDPTPEASLSIIRTAVSAGADALELGIPFSDPVAD
GPTIQRSHLRALDNGATVDSSLKLISHIRSEFPELPIGLLIYGNVPFTRGLDSFYQEFAA
AGADSILLPDVPVREGGAFIAAAQRARIAPIFIAPAQASEETLHAVATHSEGYIYAISRD
GVTGTERESSTSGLIDVVNNINKFGGAPVLLGFGISTPQHVREAIDAGARGVITGSAITA
IIERHCIGQHPAPATIDDMSALQSEIFAFISEMKAATRR
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgttaccacaatctttttacccggctagaacaatccaatgagggtgcctttgtt
cccttcatcatgcttggagaccccacccctgaagcatcattatcaatcatccgtaccgcc
gtcagtgccggcgcagacgcccttgagcttgggatcccattctcagacccagtagctgac
gggcctaccattcagcgttctcatctccgcgccctggataatggggcaacggttgattcc
tcattaaagctcatctctcacattcgttcagaattccccgaactacccatcggcctcttg
atttatggcaacgttccatttacccgtggactagatagcttctatcaagaatttgccgca
gccggcgccgattccattttgcttcccgacgttcccgtgagggaggggggagccttcatc
gcagcggcacagagagcgagaatcgcacccattttcatcgccccggcacaggcgtctgaa
gagaccctccatgcagtagcaacacattccgagggatacatctatgcaatttctcgtgat
ggagttaccggaacggaacgagaatcttccaccagtggtctcatcgatgtagtaaacaac
atcaataaattcggcggagcgccggtacttctagggttcggaatttccacgcctcagcat
gtccgtgaagcgatagatgccggcgccaggggagtaatcactggatccgcaatcactgcg
attattgaaagacactgcatcggccaacatcctgcacccgcaacaatcgatgacatgtct
gcactgcaatcggagattttcgctttcatctcagaaatgaaagcggcgactcgcagataa

DBGET integrated database retrieval system