KEGG   Chlamydia pecorum E58: G5S_0122Help
Entry
G5S_0122          CDS       T01466                                 

Gene name
miaA
Definition
(GenBank) tRNA delta(2)-isopentenylpyrophosphate transferase
  KO
K00791  tRNA dimethylallyltransferase [EC:2.5.1.75]
Organism
cpm  Chlamydia pecorum E58
Pathway
cpm01100  Metabolic pathways
cpm01110  Biosynthesis of secondary metabolites
Brite
Enzymes [BR:cpm01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.75  tRNA dimethylallyltransferase
     G5S_0122 (miaA)
Prenyltransferases [BR:cpm01006]
 Compound prenylation
  tRNA dimethylallyltransferase
   G5S_0122 (miaA)
Transfer RNA biogenesis [BR:cpm03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    G5S_0122 (miaA)
 Prokaryotic Type
    G5S_0122 (miaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IPPT IPT Zeta_toxin AAA_25 T2SSE AAA_18 AAA_5 AAA_33 DEAD SRP54 PhoH NOT2_3_5 ResIII TsaE AAA_22 AAA NTPase_1 TIP49 AAA_2
Motif
Other DBs
NCBI-ProteinID: AEB41149
Position
complement(123892..124911)
Genome map
AA seq 339 aa AA seqDB search
MLLPEPTALSIEIEQRLEPQKQFVKLFKRTVILLAGPTGSGKTEVSLKLASMIDGEIVSV
DSMQVYQGMDIGTAKVPWEMRRVIPHHLIDVCHVQEPFNVVDFYYEAIHACQAIFARNKV
PILVGGTGFYFHAFLAGPPQGPAGDVYVRSALEAHAEKVGLAALYEEVKSLDPQYALTIT
KNDRNKIIRALEIMRITGKRVSDHKWNDRPVCSSEYSCRAWFLSPHQEMLKQQLYIRCDK
MLQEGLLEEVRNLLAQGIKHNPSAAKAIGYREWIEFIECGEPEDHYLEVKQKFFSNSWRY
TKKQRTWFKRYSMFRELPTLGLTATSIAERIAEDYHLYG
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgttgctaccagaacctactgctttatctatagaaattgagcagcgtcttgagcctcaa
aagcagttcgtgaagctatttaaacgtacagtgattttgcttgcaggccctactggctca
gggaaaaccgaggtttctttaaaattagcttctatgattgacggggaaattgtctcagta
gattctatgcaagtttatcaaggcatggatattggcacggctaaggttccctgggaaatg
aggcgcgttatcccacatcatttaattgatgtgtgtcatgttcaagagcctttcaacgtt
gtcgatttttattatgaagctatccacgcgtgtcaagcaatttttgcaagaaataaagtg
cctattttagttgggggtacaggcttttattttcatgcgtttttagctggacctccgcag
ggcccagcaggagatgtctatgtacgctccgcgttagaggctcatgcagaaaaggttggt
ttggcagctctttatgaagaagtaaagtctttagatcctcaatacgccttaacgattacg
aaaaatgatcgcaataaaattattcgtgccttggaaattatgagaattactggaaagcgt
gtcagtgatcataagtggaatgaccgtcctgtctgctcatcagagtactcttgtcgtgct
tggtttctttctccccatcaagagatgttaaaacagcaattatatattcgctgtgacaag
atgcttcaagagggattgctagaagaggtgcgaaaccttttggctcaggggataaaacac
aatccctctgcggcaaaagctatagggtatcgcgaatggatagagttcatagaatgtgga
gagccagaagatcattatttagaagtcaaacaaaaatttttttctaatagctggcgatat
acgaaaaagcaaagaacatggtttaagcgctatagcatgtttcgagagctccctacgcta
gggctaactgcgacttccattgcagaaagaattgcagaggattaccatctctatgggtaa

DBGET integrated database retrieval system