KEGG   Chlamydia pecorum E58: G5S_0126Help
Entry
G5S_0126          CDS       T01466                                 

Definition
(GenBank) KH domain protein
  KO
K06960  uncharacterized protein
Organism
cpm  Chlamydia pecorum E58
Brite
KEGG Orthology (KO) [BR:cpm00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    G5S_0126
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: KH_4 KH_1 KH_2 KH_5 FAM219A
Motif
Other DBs
NCBI-ProteinID: AEB41153
Position
126526..126951
Genome map
AA seq 141 aa AA seqDB search
MDFMEEFVAYIVKNLVADPEAVQISSVEDKAKESIKVEIRVAPQDIGKIIGRRGNTIHAL
RTILRRVCARLRKKVQVDLVQPENGENIVYSDAYYDSKPEFSDQDEEVIQEDIVNDEGLE
VIEEEFLASSCKCCCGSHSQC
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
ttggattttatggaagagtttgtagcttatatcgttaaaaatttagttgctgatcctgaa
gctgttcaaatttcatctgttgaagataaagctaaggagtctatcaaagtagagatccgt
gtagcgcctcaagatattggaaaaattatcggaagaagaggcaacactatacatgctttg
aggactattcttaggcgtgtgtgtgctagattaagaaaaaaggtgcaagtagacttagtg
caaccagaaaatggggaaaatattgtgtatagtgatgcttattatgattctaagcctgag
ttttcggatcaggacgaagaagtcattcaagaggatatcgtaaacgatgagggacttgag
gttatagaagaagagtttttagcttcttcttgtaaatgttgctgtggttcccactctcaa
tgttaa

DBGET integrated database retrieval system