KEGG   Chlamydia pecorum E58: G5S_0128Help
Entry
G5S_0128          CDS       T01466                                 

Gene name
murG
Definition
(GenBank) undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase
  KO
K02563  UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [EC:2.4.1.227]
Organism
cpm  Chlamydia pecorum E58
Pathway
cpm00550  Peptidoglycan biosynthesis
cpm01100  Metabolic pathways
cpm01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cpm00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    G5S_0128 (murG)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    G5S_0128 (murG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cpm01011]
    G5S_0128 (murG)
Enzymes [BR:cpm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.227  undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase
     G5S_0128 (murG)
Peptidoglycan biosynthesis and degradation proteins [BR:cpm01011]
 Precursor biosynthesis
  Glycosyltransferase
   G5S_0128 (murG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_tran_28_C Glyco_transf_28 Glyco_trans_1_3 Glyco_transf_4 Glyco_trans_4_4 DNA_pol3_chi
Motif
Other DBs
NCBI-ProteinID: AEB41155
Position
complement(129428..130486)
Genome map
AA seq 352 aa AA seqDB search
MKGMRKVILAVGGTGGHIVPALATRELFHSKGVETLLIGKGLEGHPVIQDNNVAYREIPS
GLPALASPLVMLRRGKAILAGYQHSLKVFREFEPDLVVGFGSYHSLPVVLAAARKGLPMF
LHEQNVVPGKVNQLFSRFAKGVGVNFSTTAKRFPCPSREVFVARRTQKQHVQCSGSPRIC
VVGGSQGARILNQIVPRALCQLRETFPNIHVHHIVGPMGEIRDVEVCYTQGEISHCVKHF
ETHMLDVLISSDLVISRAGATILDELLWAKTPAIFIPYPGAYGHQQANAQFFVENIRGGE
MILETELNEKILVKKVMLALDSQTSEARRQSLCNYEKHRSRISFYQFICEHL
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgaagggcatgcgtaaggtaattttagctgttggggggactgggggacacatcgttcct
gcattagcaacgagagagctctttcatagcaaaggcgtagagacattgttaatagggaaa
ggcttagaaggacatccggtaatacaagacaataatgtagcatatagagaaattccttca
ggccttccagcattagcttctcctttagtgatgttacgtcgagggaaagcgatacttgca
ggatatcagcactctttaaaagtatttcgagagtttgaacctgatcttgttgtaggattt
ggaagctaccattctctccccgtagtattagccgcagccaggaaaggtttgcctatgttt
ttgcatgagcaaaatgttgtgccaggcaaggtaaaccagctgttttcccgttttgccaaa
ggggtaggagtaaacttttctactacagcaaaaaggttcccttgtccttctcgcgaggta
tttgtcgcaagaaggacgcaaaaacaacatgtacagtgttctggaagtccgaggatctgt
gtggttggagggtctcagggggcaagaatattgaatcagatagttcctagagctctatgt
cagcttagggagacatttccgaatatccatgtgcatcatattgttggccctatgggggaa
attagagacgtggaggtttgttatacacagggggagatttcccattgtgtaaaacatttt
gaaacgcacatgcttgatgttcttatctcttcagatcttgtaattagtcgtgcaggagct
acaattttagatgaacttctgtgggcaaagaccccagcgatttttatcccttatccagga
gcatatggccatcaacaagcgaatgcgcaattttttgtagagaatatccgggggggagag
atgattttagaaacggagttgaacgagaaaatattggtcaaaaaagtcatgcttgctcta
gattctcaaactagtgaagccagaaggcaatctctgtgtaattatgagaagcacagatct
cggatctccttttatcagtttatttgtgagcacttatag

DBGET integrated database retrieval system