KEGG   Chlamydia pecorum E58: G5S_0131Help
Entry
G5S_0131          CDS       T01466                                 

Gene name
murD
Definition
(GenBank) UDP-N-acetylmuramoylalanine--D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
cpm  Chlamydia pecorum E58
Pathway
cpm00471  D-Glutamine and D-glutamate metabolism
cpm00550  Peptidoglycan biosynthesis
cpm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpm00001]
 Metabolism
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    G5S_0131 (murD)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    G5S_0131 (murD)
Enzymes [BR:cpm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     G5S_0131 (murD)
Peptidoglycan biosynthesis and degradation proteins [BR:cpm01011]
 Precursor biosynthesis
  Amino acid ligase
   G5S_0131 (murD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C Pyr_redox Pyr_redox_2 AlaDh_PNT_C NAD_binding_2 2-Hacid_dh_C 3HCDH_N XdhC_C TrkA_N Shikimate_DH Sacchrp_dh_NADP F420_oxidored DAO NAD_Gly3P_dh_N
Motif
Other DBs
NCBI-ProteinID: AEB41158
Position
complement(132248..133507)
Genome map
AA seq 419 aa AA seqDB search
MSRHVVVLGAGVSGKSLAKYFYRLGDHVTIVDRSLKALHNIPESHVKLLEGTQELPKQVD
FVVRSPGIPPTHAWVIEAKSRGISVETDIQVALKSPEFQQYPSIGVTGSNGKTTTVSFLT
HLFHTLGLSAVSMGNIGTPILELQGVSGIRVVEISSFQLVDQEERIPVFSSAALLNVCQN
HLDYHDTMDAYMMAKSHIANYVQDPQTLWVGEGISLGKPYRAYFEETQEILDKASALKPI
YLHDRSNYCAAYALAKEVCHVPLEGFLLAIQTFKKPPHRIEYLGKKHNVHYYNDSKATTV
EAVKQALIALGSKVIVILGGRNKGGDFSALSFVLSQTAKHVIAMGECREEIVQAVAGVVP
VCMAHKLEEAIEIAQALASAGDSILLSPGCTSFDQFQNFEERGIFFKKLVGEMEALSSL
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgacatgttgtggttttaggtgccggggtctcaggaaaatctttagcgaaatac
ttttatcgtctcggggatcatgttacgattgtagatcgttctttaaaggcactacacaat
atccctgagtcgcatgtaaagcttttagaagggacgcaagagcttcctaaacaggttgat
tttgtcgtgcgctctccaggaattcctcctacgcatgcatgggtaatagaggcgaaatct
cgagggatttctgtagagacagatatccaagtagccttaaaaagtccagaatttcaacaa
tatccttctataggtgtcacagggtcaaatggaaagactacaacggtgagttttttaacg
catttgtttcatacactgggactctccgcagtatctatggggaatattggcacgcccatt
ttagagcttcagggagtttcaggaattcgtgttgtagagataagctcatttcaactagta
gatcaagaagagaggatccctgtgttctcttctgccgctttgctgaatgtatgccagaat
catcttgactatcacgatacgatggatgcctacatgatggcgaaaagccatattgctaat
tatgtgcaagatcctcaaactttatgggttggggaggggatttctttaggaaagccttat
cgggcgtattttgaagagactcaagaaattttggataaagcaagtgcattaaaaccaata
tacttgcatgatagaagtaattactgtgctgcctatgctttggctaaggaagtctgtcat
gttcctcttgaaggtttccttttggcaatacagacttttaaaaagcccccacatagaata
gagtatcttgggaaaaagcataatgtgcattactataacgatagtaaagcgacaacagtt
gaggctgtaaaacaagcccttattgctttggggagcaaggtgatagtcatattagggggt
agaaataagggtggagatttctccgctctctcttttgttctctctcaaacagcaaaacat
gttatagcaatgggagagtgtcgagaagaaattgttcaagctgtggcaggtgttgttcct
gtatgtatggctcataaattagaagaagctatagagattgcgcaagcgcttgctagtgca
ggagattctatcctattatccccagggtgcacaagcttcgatcaatttcagaattttgaa
gaacgagggattttctttaagaaattagttggagaaatggaggctttgagttctttatga

DBGET integrated database retrieval system