KEGG   Chlamydia pecorum E58: G5S_0139Help
Entry
G5S_0139          CDS       T01466                                 

Definition
(GenBank) AMP nucleosidase, putative
  KO
K01241  AMP nucleosidase [EC:3.2.2.4]
Organism
cpm  Chlamydia pecorum E58
Pathway
cpm00230  Purine metabolism
Brite
KEGG Orthology (KO) [BR:cpm00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    G5S_0139
Enzymes [BR:cpm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.4  AMP nucleosidase
     G5S_0139
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PNP_UDP_1
Motif
Other DBs
NCBI-ProteinID: AEB41165
Position
139763..140602
Genome map
AA seq 279 aa AA seqDB search
MQIAQETLERYSGSEVSAFCQYLLLTNFSYYIQTFAEIHQVPISEGSMFSAAHAPQVNTS
ILNFKLGSPGAALTVDLCSFLPEVKAALMLGMCGGLRSHYQVGDYFVPIASIRGEGTSDA
YFAPEVPALANFMVQRTTTEVLERNKANFHIGISHTTNIRFWEFNKEFRKKLYEAKVQSA
EMECATLFSAGYRRNLPIGALLLISDLPLRKEGIKTKASSNFVLKTYTKDHILTGLQVIA
ELEKAPKNRSKHHRDLPHMELGEADDTMAKGSATSDADY
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatcgctcaagaaactctcgagcgctactcaggatctgaggtttctgctttctgc
cagtacttgctgctaacaaatttttcctactacatccaaaccttcgcagaaatccaccaa
gtccccatttcagaaggctcgatgttttctgctgcccatgctcctcaagtaaatacctct
attcttaactttaaattaggctctccaggagctgcacttactgttgatctctgctctttc
ctcccagaagtcaaggctgcccttatgttaggaatgtgtggagggttacgttcccattat
caagttggggattactttgttcctattgctagcattcgaggggaagggacatcagatgca
tactttgctccagaagttcccgctctagccaacttcatggtgcaaaggacaaccacagaa
gttctcgaaagaaataaagcaaattttcatattgggatttcccacacgacaaacatccgc
ttttgggaatttaacaaagaatttcgaaaaaagctgtatgaagcaaaagtccaatctgca
gaaatggagtgtgcgacgcttttctctgcaggctatcgcagaaacctcccaattggagcg
cttttactgatttcagaccttcctttaaggaaagaggggataaaaacgaaagccagcagc
aattttgttttgaaaacctatactaaggaccacatccttactgggcttcaggtgattgca
gaactcgaaaaggctcctaaaaatcgctctaaacaccatagagacctcccccatatggag
ctaggagaggcagatgacaccatggcgaaaggctctgcaacttctgatgcagattattga

DBGET integrated database retrieval system