KEGG   Chlamydia pecorum E58: G5S_0140Help
Entry
G5S_0140          CDS       T01466                                 

Gene name
tkt
Definition
(GenBank) transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
cpm  Chlamydia pecorum E58
Pathway
cpm00030  Pentose phosphate pathway
cpm01100  Metabolic pathways
cpm01110  Biosynthesis of secondary metabolites
cpm01120  Microbial metabolism in diverse environments
cpm01130  Biosynthesis of antibiotics
cpm01200  Carbon metabolism
cpm01230  Biosynthesis of amino acids
Module
cpm_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
cpm_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:cpm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    G5S_0140 (tkt)
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    G5S_0140 (tkt)
Enzymes [BR:cpm01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     G5S_0140 (tkt)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N Transket_pyr DXP_synthase_N Transketolase_C TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: AEB41166
Position
complement(140596..142644)
Genome map
AA seq 682 aa AA seqDB search
MRIPYDRQSLLRRCKAKGMFAKECNLELLEKIAGAIKQLSIEAIQKAASGHPGLPLGCAE
LAAYLYSYVLRHNPRDPQWINRDRFVLSAGHGSAMLYACLHLSGFNVSLEEIQQFRQLHS
RTPGHPEYRETEGVEATTGPLGQGVGNAVGMALAGKMLAARFNRPEHEIFNSKVYCLAGD
GCMMEGVSHEACSLAGSLCLDNLVVIYDYNDVVLDGNLREVSVEDTRKRFEAYNWEVKEI
DGYDFPQMHEVFSEIQCNQERPVLIIAHTIIGHGSPKEGSSAAHGSPLGAEGVAQTKQFW
CLSEEKFYVPPAVKAFFSQKGHEEKKAQEKWLDDFRVWSKQFPQLHEDFLALTTHKSSSD
IEDLLRSISMPEYISGRAASNKIIQFLAQYLPYIIGGSADLSSSDGTWIRDAGVIQSHDF
TGRNIKYGVREFGMGAIMNGFAYHKVFTPFGGTFLVFSDYMRNAIRLAALSKLPVIYHLT
HDSIFLGEDGPTHQPIEQLMSLRAIPGLQVIRPADANEVKGAWQAALRFQGPTAIVLSRQ
NLPTLSYTDRHFKEGVGRGAYILKDTEGTPDYTLFATGSEVSLALSVMKELELLDKHVRV
ISFPCWEIFEEQDAAYKEKILGGDLGIRVSIEAGSALGWYKYIGSSGIAIAMDQFGVSAA
PEDAAEACGFTTELILQRILSQ
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
ttgaggataccatatgatcgccaatctttattacgtagatgtaaggctaagggcatgttc
gctaaagagtgtaacttagaacttttagaaaaaattgcaggagccattaagcagctcagt
atagaagcgattcagaaagctgcttctggtcatccagggttgccattaggatgtgctgag
ctcgcagcatatttgtatagctatgttttgagacacaatcctcgagatcctcaatggata
aatagggaccgctttgttctttctgctggacatggttccgcaatgttgtatgcatgtttg
catctttcagggtttaatgtttctttagaggagatacaacagtttcgacagttgcattct
cgaactcctggccatccagaatatcgtgaaacagaaggcgttgaagcgacaacaggccct
ttaggtcagggagtgggaaatgctgtgggcatggctttagcgggaaaaatgttggccgct
aggtttaatcgtcctgagcatgaaatttttaatagtaaggtgtactgtttagctggggat
ggctgcatgatggagggcgtgagccatgaggcttgtagtttggccggctctttatgcttg
gataaccttgtggtaatctatgattataatgatgtcgttttagatggcaatttacgagaa
gttagtgttgaagatacaagaaagcgttttgaagcatacaactgggaagtgaaagaaatc
gatgggtatgactttccccaaatgcatgaggtcttttcagaaattcaatgcaatcaagag
cgccctgtattgatcattgcccacacaattataggacacggctctccaaaagaagggagt
tccgcggctcatggctctcctttaggtgctgaaggtgtggcacaaacaaaacagttttgg
tgcctctccgaagagaagttttatgttcctcctgcagtaaaggcctttttttctcaaaaa
ggtcatgaagagaaaaaagcccaggaaaaatggctagatgattttcgtgtctggtctaag
cagtttcctcaattacatgaggattttcttgcgttaacaactcataagtcctctagtgat
atagaagatttattgcgaagcataagcatgccagaatacatttctggaagggcagcttcc
aacaaaattattcaatttttagctcaatatttaccctatataatcggtggatcagcagat
ctgtctagttctgatggcacttggatccgggatgctggagtgattcaaagtcatgatttc
acaggaagaaatattaaatatggtgtgcgcgagtttggaatgggagcaattatgaatggc
tttgcctatcataaagttttcactccttttggcggtaccttccttgttttttctgattat
atgcgtaatgcaattcgtttagcagcattgtcgaaactccctgtgatctatcatctcact
catgattctattttcttaggtgaggatggacccacacatcagcccatcgaacagctaatg
tctttacgagccatccctggactgcaggtaattcgtcctgcagatgctaatgaagttaaa
ggagcttggcaagcagcattgcggtttcaggggccaacagcgattgtgttgtcgcgtcag
aatctcccgacgttgtcctatacagatcgtcattttaaagagggcgtagggagaggagca
tatattttaaaagatacagagggaacacctgattataccttgtttgcaacaggatctgaa
gtttctttagcactttctgtaatgaaggagttagagcttttagataagcatgtgcgtgtg
atttctttcccttgttgggagatctttgaagaacaagatgccgcgtataaggaaaaaatc
ctcgggggagacttaggcatccgggtgtctatagaagctggttctgcgttaggctggtat
aagtatattggctcttctgggattgccattgctatggatcaatttggggtttctgctgct
ccagaggatgctgctgaagcatgtgggtttaccacagaattgatcttacaaagaatcctt
tctcaataa

DBGET integrated database retrieval system