KEGG   Chlamydia pecorum E58: G5S_0145Help
Entry
G5S_0145          CDS       T01466                                 

Gene name
hemN
Definition
(GenBank) oxygen-independent coproporphyrinogen III oxidase
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
cpm  Chlamydia pecorum E58
Pathway
cpm00860  Porphyrin and chlorophyll metabolism
cpm01100  Metabolic pathways
cpm01110  Biosynthesis of secondary metabolites
Module
cpm_M00121  Heme biosynthesis, glutamate => heme
Brite
KEGG Orthology (KO) [BR:cpm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    G5S_0145 (hemN)
Enzymes [BR:cpm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     G5S_0145 (hemN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM HemN_C
Motif
Other DBs
NCBI-ProteinID: AEB41170
Position
149622..151016
Genome map
AA seq 464 aa AA seqDB search
MSNTLSPMFNIDFKFLEGLHQPAPRYTSYPTALEWEPSDEAPARVALQRIKNSPQPLSLY
FHIPFCQSMCLYCGCTVILNRREEIVEDYINTLLQEISLISQELGMKFPVSRIHFGGGTP
SRLSRYMFEKLFHQLHKCFDLSQTEEIAIEIDPRSLRNDMEKAEFFQNLGFNRVSLGVQD
TQAAVQEAVKRRQTHEESRRVYEKFKELGFTSINIDLIYGLPKQTRHTFAQTIQDILAMR
PDRLALFSYAAVPWIKPHQKAIKATDLPSMEEKFAIYSQSRHSLIKAGYQAIGMDHFSLP
EDPLTVAFHNKTLIRNFQGYSLPPEEDLIGLGISATSFIRGIYLQNTKALDIYQEKILSH
SLATEKSKELSKDDLIRKWVIHKLMCTFVIEKEEFFSLFGHSFDEYFSDSQERLLSMERT
GLIQNSSSFLTVTPLGELFVRVIATAFDHYFLKKVSSPRFSASI
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgtccaacacgttatcgcctatgttcaacatcgattttaaattcctagaaggacttcat
caacccgcaccaagatatacaagctaccctacagctttagaatgggagccttctgatgaa
gcccctgcacgcgttgctctgcaaagaataaaaaattctccccaacctttgtctttgtat
ttccacattcccttttgccaatcgatgtgtctgtattgtggatgtactgtgattctcaac
cgcagagaagagattgttgaggactacatcaatacgctcctccaagaaatctctcttatc
tcgcaggaattaggaatgaagttccccgtttctcgaatccattttggaggaggcactcct
agccgtctttctcggtatatgttcgagaagctctttcatcaactccacaaatgctttgat
ctctcccaaacagaagagatcgcgatagagatagacccacgttctttaaggaacgatatg
gagaaggcggagtttttccaaaatcttgggtttaatcgtgtaagcttgggagtacaagat
acccaagctgccgtacaagaagccgtaaagcgacggcagacccatgaggagtcacgacgt
gtgtatgagaagtttaaagagctgggctttactagcatcaacattgatctaatctacggc
ttgccaaagcaaacccgtcacacctttgcgcaaactatccaagacatcctcgcaatgcgc
ccggatcgtctggcattattttcttatgctgcagtcccttggatcaaaccgcaccaaaaa
gcaatcaaagctacagatcttccctctatggaagaaaaatttgcgatatactcacaatcc
cgacatagcttaatcaaggcaggctaccaagctattgggatggatcatttttctcttccc
gaagatcccttaacagtagcgtttcataacaaaacattaattcgtaattttcaagggtat
tccctgcctcccgaagaagaccttatcggactaggaatctctgcaacaagttttattcgt
ggaatatacctgcaaaatacgaaagctctcgatatctatcaggagaagatcctttcacat
tctctagcgacagaaaaaagcaaagagctctccaaggatgacctgattcgaaaatgggtc
atccataagcttatgtgtacctttgttatagaaaaagaagagtttttctctctttttggt
catagctttgatgaatatttttctgatagccaagagaggcttctaagtatggaacggaca
gggttaatccaaaatagctcgtcatttcttactgtcactcccttaggggagcttttcgtt
agggtgatcgctaccgcatttgaccactatttcttaaagaaagtatcttcaccgcgattt
tcagcatcaatatga

DBGET integrated database retrieval system