KEGG   Chlamydia pecorum E58: G5S_0147Help
Entry
G5S_0147          CDS       T01466                                 

Definition
(GenBank) phosphoprotein
Organism
cpm  Chlamydia pecorum E58
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPR_12 TPR_10 TPR_2 TPR_7 TPR_8 ANAPC3 TPR_1 PPR
Motif
Other DBs
NCBI-ProteinID: AEB41172
Position
complement(152281..154689)
Genome map
AA seq 802 aa AA seqDB search
MKRITHIAQRMVILCFFLPFQMYTSPAEHNKTFGACCSDVHAALESQGDCESLLQEFVHR
IFQDRAKLSARDWQTVGVLVKQYIYKCLREKRIDKSKEILQQLLSFPLPNAVKNELRILW
QSLNPENMPLQHFIEQFSSLNVGDSLQYRLLMDLYKMTLHSSYEERKQSVLLAKERGLYR
EAYDQAVALLQAIEKGECCPHEEVAAIETCFLKKTLLALQILLAENPEMYESLIPSYYLT
EIAHTEAIDMLVERIAQGEVSRSDEVDSVLLSHAIRRFPVDPQKTIQELEVLIDGGKHLQ
SRVLYHGYFFLLEIYLQHKHFPAMERLLRFGEAIFDADHEAFPEYQYFLGAYLYALGKHS
QAFNIFSGALSSAIRCGVTLAKIYEYLGCISCSQKNYSQAEEYFLRAYKGWDREEAGIGL
FLTFMAQGKKEECAKMLQSSNFSFKTQRFLEAFSSERGGALESCVSKISPCPSVSDIYSR
CIYFMMKSLSFLSKGPVFELAQEVLNMMEVAFLTQVQQICPDLKECTALEFWKHKLAKTS
SQRNLAAPGEPHVLTLCYRALYNEDQEAISLLPMLFSEESSALQSALRLVWVLTKNDDKK
DSRYCHNLPLRPCGDRLYLLAYPLKEYFEGREEALQHLSLFPELFPHSSLLTLAYYLLGC
GEPSLFLRAAWFVKALAEFPKISLFGEDAEAWVYMYYDIKCSLADAYFSLGDPIRAVEML
EEVKEDWYVHHHPYLQLLGKETYRNSIERRWVQGLAHGYAILNEKTRLAHHLLQHIEKTL
LLTRSLQGALAITEALSSGPHL
NT seq 2409 nt NT seq  +upstreamnt  +downstreamnt
atgaagagaataacacacattgctcaaaggatggtgattttgtgttttttccttccattt
cagatgtatacatctcctgctgagcataacaaaacttttggggcgtgttgtagtgatgta
catgctgcactagagtctcagggggattgtgaatcattattgcaagagtttgtgcatcgt
atttttcaggatcgtgcgaagttatctgctcgggattggcagactgtgggagtgttagta
aagcagtatatttataaatgccttcgagaaaaacgtatagacaagagcaaggagatacta
cagcagctgctttctttccctttacctaatgcagtgaaaaacgaactgcggattctttgg
cagagcctaaatcctgaaaacatgcctttacaacattttattgagcaattctcctcctta
aatgtgggagattctctacagtatcgcctgcttatggacctttataaaatgactctgcat
agtagttatgaagagcgtaagcaaagtgtgcttttagctaaagagcgcggactttacaga
gaagcctatgatcaagctgtggcattattgcaggcgatagaaaaaggtgagtgctgccct
catgaggaagtcgctgctattgaaacgtgctttttgaaaaagaccctactagcattgcag
atccttttggcagaaaatccagagatgtatgaatctctgataccttcgtattaccttacg
gaaattgctcatacagaggcaatcgatatgttagtagagcgcatcgcacagggagaagtc
tcccgttctgacgaggttgattctgtccttctttctcatgcgatacgtcgcttccctgta
gatcctcaaaaaactattcaggagttagaggtgcttatagatggcggaaagcacctacag
tcgagagtcctctatcatggttatttttttctattagagatctacctacagcataaacat
ttccccgcaatggagcgcctgctgcggtttggggaagctatttttgatgcagatcatgag
gctttccctgaatatcagtattttctaggagcgtatttgtatgctcttggaaagcactct
caggctttcaatatcttctctggggctctttcttctgcgattcgctgtggggtgacgtta
gctaaaatttatgagtatttggggtgcatctcttgttcgcaaaagaactattctcaggca
gaggagtatttcttaagggcatataagggatgggatcgtgaagaagctgggatcggtctg
tttcttacattcatggcgcaagggaaaaaagaggaatgcgctaagatgctgcagtcatcg
aatttttcttttaagacgcagaggtttctcgaagctttctcttcagagagagggggagct
ctagagtcttgtgtttccaaaatttctccatgtccttctgtgtcggacatctatagtcgc
tgcatttactttatgatgaagtccctctcttttctttctaaaggccctgtttttgagctc
gcccaggaagtcctcaatatgatggaagtggcatttctaactcaggtacaacagatttgt
ccggatcttaaggaatgtacagctttggaattctggaaacacaagcttgcaaaaacctct
tctcagagaaacctagcagctccaggagaaccacacgtgcttaccctatgctatagggca
ttatataatgaggatcaggaagctatttctttgctccccatgttgttttctgaggagagc
tctgcactacagtctgccttacggttagtatgggttttaactaaaaacgacgataaaaaa
gattcccgctattgtcataatcttcctttacgtccttgtggagatcgtctatatttactt
gcctatcctcttaaggagtatttcgaaggtcgagaagaggctcttcagcatctttctttg
ttcccagaacttttcccgcattcttctttgcttacgcttgcttactacctgttgggctgt
ggagagccttcattatttttaagggccgcatggtttgtgaaagctctggcagagttccct
aaaatttccttatttggggaagacgctgaagcttgggtgtacatgtattacgatataaaa
tgcagtcttgcagatgcgtatttttccttaggggatcctattcgggctgtggagatgttg
gaagaggtaaaagaggattggtatgtgcatcatcatccgtatttgcagcttttagggaag
gaaacttacaggaattctatagagcgcaggtgggtgcagggcttagcgcatgggtatgct
atccttaatgaaaagactcgccttgcccatcacttacttcagcatattgaaaaaacattg
ttgctaacgcgctctcttcagggagcattagcaattacagaggcactatcttcggggcct
cacctttaa

DBGET integrated database retrieval system