KEGG   Chlamydia pecorum E58: G5S_0151Help
Entry
G5S_0151          CDS       T01466                                 

Definition
(GenBank) preprotein translocase, YajC subunit
  KO
K03210  preprotein translocase subunit YajC
Organism
cpm  Chlamydia pecorum E58
Pathway
cpm02024  Quorum sensing
cpm03060  Protein export
cpm03070  Bacterial secretion system
Module
cpm_M00335  Sec (secretion) system
Brite
KEGG Orthology (KO) [BR:cpm00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    G5S_0151
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    G5S_0151
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    G5S_0151
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:cpm02044]
    G5S_0151
Secretion system [BR:cpm02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components [MD:M00335]
   G5S_0151
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YajC MFS_1 T2SSM
Motif
Other DBs
NCBI-ProteinID: AEB41176
Position
156875..157225
Genome map
AA seq 116 aa AA seqDB search
MRSYITCFLFLLASLQVFAEDDMAQAKNTFLQPAVMLAIAILFFYFILWRPEQKRRKAAE
KRKNELAKGDKVTAMGIIGVIDEVREHTVVLNIASGKIEILKAAISEILKPDGTRA
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atgcggtcttacattacatgttttttatttttgctggcgtctttacaagttttcgctgaa
gatgacatggcccaagctaaaaatacctttttacagccagctgtgatgcttgccattgcg
attttatttttctattttattctatggcgtccagagcaaaagcgcagaaaagctgcagaa
aaacgtaaaaatgaactcgctaaaggggacaaagttaccgcaatggggattattggcgtt
attgatgaagttcgtgagcacacagtcgtgttgaacattgcttctggaaaaattgaaatc
ctcaaagcagcaatttctgaaatcctgaaaccagacgggacaagagcttaa

DBGET integrated database retrieval system