KEGG   Chlamydia pecorum E58: G5S_0152Help
Entry
G5S_0152          CDS       T01466                                 

Gene name
nqrF
Definition
(GenBank) NADH:ubiquinone oxidoreductase, Na(+)-translocating, F subunit
  KO
K00351  Na+-transporting NADH:ubiquinone oxidoreductase subunit F [EC:1.6.5.8]
Organism
cpm  Chlamydia pecorum E58
Brite
KEGG Orthology (KO) [BR:cpm00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    G5S_0152 (nqrF)
Enzymes [BR:cpm01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.8  NADH:ubiquinone reductase (Na+-transporting)
     G5S_0152 (nqrF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2 NAD_binding_1 FAD_binding_6 Tagatose_6_P_K DUF4083
Motif
Other DBs
NCBI-ProteinID: AEB41177
Position
157327..158622
Genome map
AA seq 431 aa AA seqDB search
MAWLSNVTFILVSCIVFCLIGLVLSGVILLARKFFIKEHPCKLTINNNDALSKTVISGKS
LLATLSDIGIAIPSPCGGKATCKQCKVRIVKNADAPLETDRGTFTKQQLQQGWRLSCQTK
VQHDLGLEIEERYLHASTWEGTVVSNDNVATFIKELVVRIDPKTPIPYKPGGYLQITVPP
YKTNSSDWKATMAPEYYSDWEHFHLFDTEIDYRQLAPASTNKAYSLASHPAEFPLIKFNV
RIATPPIVEGRPQPEIPWGVCSSYIFSLKPGDVISVSGPYGESFMIDDDRPLVFLIGGAG
SSFGRSHILDLLLEKHTKREISLWYGARSLKENIYQDEYEQLEKQFPNFHYHLVLSNPLP
EDIAAGWDKNDPIKTNLLFQAFELGMLKQLENPEDYLYYVCGPPLHNSSILKLLENYGVE
RSSIILDDFGS
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atggcttggctctctaatgttaccttcattcttgtttcctgcattgttttttgtcttata
ggtttagtcctttctggagttattctcctcgctagaaaattttttattaaagagcatcct
tgcaagctcactattaacaacaatgacgccctatctaaaactgtaattagcgggaaatct
ctcttagcaaccctttcggatattggtatcgcgatcccctctccttgcggaggaaaagca
acctgtaaacagtgcaaggtacgtattgttaaaaatgccgatgcccccctagaaactgac
cgcgggacctttactaagcagcagctgcaacaaggatggcgtctttcctgtcaaaccaaa
gtacagcatgatctgggcctagagatagaagaacgttatttgcacgcctctacatgggaa
ggtacggtagtctccaatgataacgtcgcaacattcataaaagagctggtcgttcgtata
gatcctaagacccctatcccatacaaacctggaggctacttacaaattaccgtacctcca
tacaaaactaactcttctgattggaaagcaaccatggctcctgaatactatagcgattgg
gagcactttcacttatttgataccgagattgattatcgtcagcttgctccagcgtctaca
aacaaggcctattcattagcatcgcatcctgcggagtttcccctgattaaatttaatgta
agaattgccactcctccaattgttgagggcagacctcaaccagagattccttggggtgta
tgttcttcctatattttctctctaaaacctggagatgtcatttcagtttcaggcccttat
ggggaatcctttatgattgatgacgaccgacctctagtatttctgattggtggagcgggc
tcatcatttggaagaagtcatattctcgatttattattagaaaagcatacgaaaagagag
atctcactatggtatggggcacgttctttaaaagaaaacatctaccaagatgaatatgaa
caattagaaaagcaatttccgaatttccattatcatctcgtgctctctaaccctcttcct
gaagatattgctgcagggtgggataaaaatgaccccataaaaacaaacttattatttcaa
gcatttgagcttggcatgcttaaacaattagaaaatcctgaagactatttgtattatgta
tgtggcccaccactgcacaatagcagtattcttaaacttctagagaactatggagtagaa
cgctcctccattatcttagatgatttcggaagctag

DBGET integrated database retrieval system