KEGG   Chlamydia pecorum E58: G5S_0172Help
Entry
G5S_0172          CDS       T01466                                 

Definition
(GenBank) conserved hypothetical protein
Organism
cpm  Chlamydia pecorum E58
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VIT1
Motif
Other DBs
NCBI-ProteinID: AEB41190
Position
176890..177630
Genome map
AA seq 246 aa AA seqDB search
MTSQNHFYSRTPEQHVRMVRDKHGVCKGEPYTTSKGLFYHLAGDALSSGVFLFFIRTLFF
LTPLAHSFQTKLLISLGIGWAFYQGAFKAKEAWSYMELSHRSMFQEKEEIERHFDQEKEE
LRVIFSNQGFKGPLLEDMIEYVCSDTTLLLDIMIREELHICKEAFPHPLTQGGVRMLGNL
LGLMLFLPFTLCASYSLAGFFSTLLIVVLSIFKAKILENSAIVDSVWSAGIFLTAISIIC
SFIKFL
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgacgtctcaaaatcacttttattcccgtacaccagaacaacatgttcgcatggttaga
gataaacatggcgtatgtaagggagagccctataccacctctaaggggcttttttaccac
ttagcaggagatgctctatcctctggagtatttttatttttcatccgcaccttatttttc
cttacccctttagctcatagctttcaaaccaaactcctcatctcactaggaataggctgg
gccttttatcaaggggcattcaaagcgaaggaagcttggtcctatatggagctttctcat
cgctctatgtttcaggaaaaagaggagatagaacgccactttgatcaggagaaggaagag
cttcgcgtgatcttttcaaaccaagggtttaaagggcctctccttgaggatatgatagag
tatgtttgctcagataccaccctactgttagacatcatgatccgtgaagagctccatatc
tgcaaagaagctttcccacaccctctaacccaaggaggtgtacgcatgttagggaacctt
ttaggcctcatgctctttctgccctttacactatgtgctagctattccctcgcagggttc
ttctctactctcctcattgttgtgctttctatttttaaagcaaaaattttagagaatagt
gcaatcgtagattctgtatggagtgcggggatcttccttacagctatcagcattatctgt
tcttttataaagtttttatag

DBGET integrated database retrieval system