KEGG   Chlamydia pecorum E58: G5S_0184Help
Entry
G5S_0184          CDS       T01466                                 

Definition
(GenBank) flagellum-specific ATP synthase
  KO
K02412  flagellum-specific ATP synthase [EC:3.6.3.14]
Organism
cpm  Chlamydia pecorum E58
Pathway
cpm02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:cpm00001]
 09140 Cellular Processes
  09142 Cell motility
   02040 Flagellar assembly
    G5S_0184
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:cpm02044]
    G5S_0184
   02035 Bacterial motility proteins [BR:cpm02035]
    G5S_0184
Enzymes [BR:cpm01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.14  H+-transporting two-sector ATPase
     G5S_0184
Secretion system [BR:cpm02044]
 Type III secretion system
  Flagellar export apparatus
   G5S_0184
Bacterial motility proteins [BR:cpm02035]
 Flagellar system
  Flagellar assembly proteins
   Type-III secretion
    G5S_0184
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-synt_ab ATP-synt_ab_N ABC_tran ArgK
Motif
Other DBs
NCBI-ProteinID: AEB41202
Position
187017..188318
Genome map
AA seq 433 aa AA seqDB search
MTYLNKEKIHLHHWQPYRACGLLSRVSGNLLEAHGLSACLGELCKISSTQSSELLAEVIG
FHNQTTLLMSLSPLYGVALGTEVLPLRRPPSLHLSDHLLGRVLDGLGNPIDNQKDLPKTH
RKPLISPPPPPMTRKPIHEVFPTGIKAIDACLTLGKGQRIGVFSEPGSGKSSLLSSIALG
SKSTINVIALIGERGREVREYIERHKEALKKHQTVIVTAPAHETAPIKIIAGRVAMTIAE
FFREQGHDVLFIMDSLSRWISALQEVALARGETLSSHHYAASVFHHVSEFTERSGNSDQG
SITALLAILHYPDHPDVFTDYLKSLLDGHFFLSNQGHAFTSPPIDILSSLSRSAQSLSLP
HHYAAAEKLRSLLKVYNEALDIIRLGAYTPGQDKDLDEAMKLIPSIQAFLSQPLTNYCNF
DTTIKQLETLLHS
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgacttacctaaacaaagagaaaatacatctccatcattggcagccctaccgcgcgtgc
ggcttgctatctcgagtgtctgggaatctcctagaagcacacgggttatctgcatgcctc
ggagaactatgcaaaatctcttcaacacaatcttcagaacttcttgcagaggtcatcggc
ttccacaaccagacaaccctgctcatgtcgctatctcccttgtatggagttgccttagga
acagaagttctccccttgcgtcgtcccccctctttgcatctttcagatcaccttctaggc
agagttttggatggcttagggaaccctatcgacaaccaaaaagacctaccaaaaacccac
cgtaagccgctgatttccccaccccctccccctatgacgaggaaaccgatccatgaagtc
ttcccgacaggaattaaggcgatagatgcctgtttaaccctaggaaagggacaacgcatt
ggcgtcttctcagaacctgggagcggaaaatcttctcttctctcttctattgccttagga
tcgaaatccacaatcaatgtgatagcattaattggagagcgtggaagggaagttcgtgaa
tacatagagcgccataaagaagctctaaaaaaacatcaaaccgtgattgttacagccccc
gcacacgaaactgctcctataaagattatagcgggtcgtgtagccatgaccattgcagaa
ttttttcgcgagcaaggccacgatgtactatttattatggactcgctttcccgttggatc
tcggctctacaagaagttgcccttgctcgcggagagactctctcttctcaccactatgct
gcttcggtattccatcatgtttctgagttcacagagcgctcaggaaatagcgatcagggc
tccatcacagcactcttggcaattttgcactatcccgatcaccccgatgtatttacagat
tatttaaagtcccttttggatgggcactttttcctctccaaccaaggacatgcttttacc
tctccccccatagatatcttatctagcctctcacgatccgcgcaatctctctctcttcca
catcactatgctgcagcagaaaaactccgttctttacttaaggtatacaatgaagcctta
gatattatccgcctaggagcgtatactccaggacaagataaagaccttgatgaagctatg
aagctaatcccaagcattcaagcgtttctttctcaacctcttacaaattactgtaacttt
gatacgaccataaaacagttggaaacgttacttcattcatga

DBGET integrated database retrieval system