KEGG   Chlamydia pecorum E58: G5S_0185Help
Entry
G5S_0185          CDS       T01466                                 

Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase family protein
  KO
K00972  UDP-N-acetylglucosamine/UDP-N-acetylgalactosamine diphosphorylase [EC:2.7.7.23 2.7.7.83]
Organism
cpm  Chlamydia pecorum E58
Pathway
cpm00520  Amino sugar and nucleotide sugar metabolism
cpm01100  Metabolic pathways
cpm01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cpm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    G5S_0185
Enzymes [BR:cpm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.23  UDP-N-acetylglucosamine diphosphorylase
     G5S_0185
    2.7.7.83  UDP-N-acetylgalactosamine diphosphorylase
     G5S_0185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDPGP NTP_transf_3 NTP_transferase
Motif
Other DBs
NCBI-ProteinID: AEB41203
Position
188722..190077
Genome map
AA seq 451 aa AA seqDB search
MDMPSLAEKLRAIKQEHLLCFWPTLSPKQQYRLYSQLSSLDIQLFQQQQQLLSSPTPLPK
NFRPVSSFASSGEDPERTKTGTSLLKEKKVACVVLAGGQGSRLKCDGPKGLFPVSPIKKK
PLFQLVAEKVCAASKLAGQTLPLAFMTSPLNNRQTRSYFESNAYFSLDPNHVDFFCQPLW
PLLNLSGELFLEDESTLALGPNGNGCLATLLLTSGIWEKWHNIGIEMVSVIPIDNPLALP
FDVELCGFHAMENNEVTIKATLRQTAIEDVGILVESEDSGKTSVIEYSEIPQDERFSMHP
NGKLEYGLANIGLYCLSMDFIRKAAHKTLPLYKARKYAKQLGQISSTEKNAWKFEEFIFD
LFCYSEQCRTLVYPRQECFAPLKNLEGNHSLDTVRQALSARERQLFHEVTGKQLSPNTTF
ELEADFYYPLTSTSLHWENKAFFEEPFFEAS
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atggatatgccctcgctagcagaaaaactcagagctataaagcaagaacatcttttatgc
ttttggcccacactctccccaaagcagcaataccgtttgtattcccagctttcttctctt
gatattcaacttttccaacaacaacaacagcttctttcttctccaactcctcttcctaaa
aatttccgtcctgtatcttctttcgcttcctcgggggaagatcccgaaagaacaaaaaca
ggcacctctcttcttaaagaaaaaaaagtggcttgtgtcgtgctcgcagggggacagggc
tctcgccttaaatgtgacggccctaaggggttatttcctgtatcgccaattaaaaaaaag
ccgctctttcaacttgttgctgaaaaggtctgtgcagcaagtaaacttgctgggcagact
ttacccttagcttttatgacctctcccctaaataacagacaaacccgctcctattttgag
tcaaatgcctatttctctttagatccaaatcacgtcgattttttctgtcagccattatgg
cccttacttaacctctctggagaattatttctcgaagatgaatccacattagctttaggc
ccaaatggaaatgggtgcttagcgacactccttctcacctcggggatctgggaaaaatgg
cataatatcggcatcgaaatggtcagcgtgatccccatagataaccctctggctcttcct
tttgatgtggagctctgtggatttcacgcgatggaaaataacgaagtcacgatcaaagca
acactaagacaaactgccatcgaagatgttgggatcctcgtggaatcagaagattctggg
aaaacttctgttattgaatattctgagatcccccaagatgaaaggttctctatgcatcct
aacggcaagctagagtacggtttggcaaacatagggttgtattgcctatctatggatttc
atccgtaaagcggcacataaaactctacctttatacaaagcacgcaaatatgcaaagcaa
cttggccaaatctcatccacggaaaaaaatgcttggaaatttgaagagtttattttcgat
ttattctgctacagcgagcaatgtcgtactcttgtctacccacggcaagaatgctttgcg
ccattaaaaaatctcgaaggaaatcatagtttagatactgtaagacaagccctctctgca
agagagcgtcagctcttccatgaggttacagggaaacagctctctccaaatacaacattt
gaattagaagcagatttttattatcctttaacttctacttccttacactgggaaaataaa
gcctttttcgaggaaccgttttttgaggcctcatga

DBGET integrated database retrieval system