KEGG   Chlamydia pecorum E58: G5S_0187Help
Entry
G5S_0187          CDS       T01466                                 

Definition
(GenBank) Glycerol-3-phosphate dehydrogenase
  KO
K00057  glycerol-3-phosphate dehydrogenase (NAD(P)+) [EC:1.1.1.94]
Organism
cpm  Chlamydia pecorum E58
Pathway
cpm00564  Glycerophospholipid metabolism
cpm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cpm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    G5S_0187
Enzymes [BR:cpm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.94  glycerol-3-phosphate dehydrogenase [NAD(P)+]
     G5S_0187
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_Gly3P_dh_C NAD_Gly3P_dh_N NAD_binding_2 F420_oxidored 3HCDH_N ApbA UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: AEB41204
Position
190074..191078
Genome map
AA seq 334 aa AA seqDB search
MTEKIAYLGMGIWGFCLATLLAKKGFRVQGWSRNPQLIAELQQKQRHPRAPEIPISPNLT
FSTDLAETLEGASMIIEGVSSAGIRPIAKQLKQISPLSVPFVITSKGIEQNTGLLLSEIM
LEVFGNSAKQYLGYLSGPSIAKEVLKNCPCSVVISAYDPETLKHIHQAFATPTFRVYPNT
DVKGVALGGALKNIIAIACGISEGFHFGNNAKAGLVTRGLHEMRKLASIMGCRPETLNGL
AGLGDLCVTCFSEFSRNLQFGKLIAEGYTLEQAKEKIGMVVEGAYTALSAHQIAQHHHIE
MPITTGIYRVLYENLDLQEGIAMLLQRSTKEEYL
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgacagaaaaaatcgcctacttaggcatgggaatctggggattctgtttggcaacgctg
ctggcaaaaaaaggttttcgtgtgcaaggatggtctcgaaatccccagcttattgcggag
ctccagcaaaagcaacgacatccacgagctcctgaaatcccaatttctccaaaccttacc
ttctctacagaccttgcagaaactctagaaggggcctcaatgatcattgagggagtatct
tctgcaggaattcgtcctattgcgaaacaactgaagcagatttcccctttatccgtgcct
tttgtcattacttctaagggaatcgagcaaaacacaggactcttgctcagcgaaattatg
cttgaagtctttgggaattctgcaaagcaatatcttggttaccttagcggcccttctata
gcgaaagaagtcctgaaaaattgcccatgttctgtcgtgattagcgcctatgatccagaa
actctcaagcatatccatcaagcatttgcaacaccgacatttcgcgtctatcctaatacc
gacgttaaaggagtagctttgggaggcgccttaaaaaatatcatcgcaatcgcttgtgga
atctcagaagggttccattttggcaacaacgctaaggcgggtcttgtcactcgaggtctc
catgaaatgcgcaaacttgctagcattatgggatgtcgtcccgaaaccttaaatggctta
gcaggacttggagatctttgtgtaacatgcttttcggagttcagtagaaacttacaattc
gggaagcttatcgctgaagggtataccttagagcaagcaaaggaaaagatcggcatggtg
gtggaaggtgcctatacagcgctctctgctcatcagatcgctcagcatcatcatattgaa
atgcccatcactacggggatctatcgtgtcctttatgaaaaccttgatctccaagaaggc
atagctatgctgttacaaagaagcacaaaagaagagtatctctag

DBGET integrated database retrieval system