KEGG   Chlamydia pecorum E58: G5S_0192Help
Entry
G5S_0192          CDS       T01466                                 

Definition
(GenBank) rod shape protein-sugar kinase
  KO
K03569  rod shape-determining protein MreB and related proteins
Organism
cpm  Chlamydia pecorum E58
Brite
Chromosome and associated proteins [BR:cpm03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    G5S_0192
Cytoskeleton proteins [BR:cpm04812]
 Prokaryotic cytoskeleton proteins
  Actin homologs
   Actins
    G5S_0192
Prokaryotic defense system [BR:cpm02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    G5S_0192
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MreB_Mbl HSP70 FtsA Actin PilM_2 EutA DDR Ppx-GppA
Motif
Other DBs
NCBI-ProteinID: AEB41209
Position
complement(197601..198701)
Genome map
AA seq 366 aa AA seqDB search
MSAHRSLFKIKNFSNRLYNKALGRFDKVFNFFSGSVGIDLGTANTLVYVRGRGIVLSEPS
VVAVDAQTHAVLAVGHKAKAMLGKTPRKIMAVRPMKDGVIADFEIAEGMLKALIKRVTPS
RSVFRPRILIAVPSGITGVEKRAVEDSALHAGAQEVILIEEPMAAAIGVDLPVHEPAASM
IIDIGGGTTEIAIISLGGIVESRSLRIAGDEFDECIINYMRRTYNLMIGPRTAEEIKITI
GSAYPLGDQELEMEVRGRDQVAGLPITKRINSVEIRECLAEPIQQIIECVRLTLEKCPPE
LSADLVERGMVLAGGGALIKGLDKALSKNTGLSVITAPHPLLAVCLGTGKALEHLDQFKK
RKGNMV
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcgcatcgtagcctttttaaaattaagaatttttctaatcgtttgtataacaag
gctttggggcgttttgataaagtttttaatttcttctctggcagtgtaggaattgattta
ggtactgcgaacactttagtgtatgtccgaggccgtggcattgttctcagtgagccttcg
gttgttgctgtcgatgcacaaacccatgcagttcttgctgtggggcataaagcgaaagca
atgttagggaaaactcctcgaaagattatggctgtgcgcccaatgaaggatggagtgatt
gcagattttgaaattgcagaaggcatgcttaaagctttaattaaacgagttacgccttct
cgaagtgttttccgcccaagaattttgatagcagttccttcaggcatcacaggagtggaa
aaacgtgctgttgaagactctgcgctgcatgcaggggctcaagaggtgattttaatcgaa
gagcctatggctgctgcgattggggtcgaccttcctgttcatgagccggcagcgagtatg
atcatagatattggtggaggaactacggaaattgcaattatttccttaggagggattgta
gaatctcgttccttacgtattgctggtgatgagtttgatgagtgtattattaattacatg
cgtcgtacgtataatttgatgattgggcctcgtactgctgaggagattaagattacgata
ggttctgcgtatcctttaggggatcaagaattagaaatggaagttcgtggtcgggatcag
gttgcgggtttgccgataacaaaacggattaactctgtagaaattcgtgagtgtttagca
gagcccattcaacaaattatagagtgtgtaagattaacgttagaaaagtgccctccggag
ctttctgctgatttagttgaacgtgggatggtattggctggaggaggtgctttgataaaa
ggtttggacaaagcattaagtaaaaatacaggactttctgttatcacagcaccacatcct
ttattagctgtgtgtttaggcacagggaaggctttagaacatctagatcaatttaagaag
cgcaaggggaatatggtatag

DBGET integrated database retrieval system