KEGG   Chlamydia pecorum E58: G5S_0195Help
Entry
G5S_0195          CDS       T01466                                 

Definition
(GenBank) trigger factor
  KO
K03545  trigger factor
Organism
cpm  Chlamydia pecorum E58
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trigger_C Trigger_N DUF1456 SLED FKBP_N
Motif
Other DBs
NCBI-ProteinID: AEB41211
Position
202570..203814
Genome map
AA seq 414 aa AA seqDB search
MSPALFSTLHKQALKKVKKNVSIPGFRKGKVPDDIIENRYPHPIRKECNELLVHTAYTSL
STLGDRKPLSPQAVQSTSIKEADLANGGVVEFIYEAFPVVPEISWESLFLPEATQHKEVS
DEDVEKSLNNIAHFFATKTPVTRPSQEGDFISLSLHISKQDDESFLVPIFENKYFKLSDE
EMSETFKEKFLGVSVGHRVVEYVSSSEIQSFLNGDTLIFTVNAVVEVEVPELDEEKARQL
QVDSLEELKSKLRAQLENQAKDKQHQQRFVETEDALAAMADFELPANLLKDRISMLTREK
LLNARLIEYCSNEELESRKQKLLKEAEDSAVKALRLLFLTRKIFEDEKLSFTREELQYMI
EVCSRERFGPQPPKDISNEMLQELVSAARDRLTYSKAIEKAREKAEKLAVSSLA
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
gtgtctcctgctttattcagcacgctgcataaacaagcccttaaaaaagttaaaaaaaac
gtttccattccagggtttcgcaaaggaaaggtccctgatgacattattgagaaccgctac
ccccatcctatacgtaaagaatgtaatgagctccttgtacacactgcttacacctcttta
tctactttaggagatcgcaaacctctttctcctcaagcggtgcaatccacctcaattaaa
gaagcagatttagcaaacgggggagtagtagaatttatctatgaagcgtttcctgtagtt
ccagagatttcttgggagtctttatttctcccagaggccacacagcacaaagaagtttct
gatgaagatgttgaaaaaagtttaaataatatcgctcacttcttcgcaaccaaaactcct
gtaacacgtccttctcaagaaggagacttcatttctttatctttgcatatttctaagcaa
gatgatgaaagctttcttgttccaatttttgaaaataaatatttcaagctttctgatgaa
gagatgtcagaaacctttaaagagaaatttctaggggtttctgttggccatcgtgttgtc
gaatatgtttcctcctcagaaatccaatcatttttaaatggggacaccttaatttttaca
gtgaatgctgttgtagaggttgaggttccagagctagatgaagagaaggcgcgtcaactt
caagtagattcattagaagaactcaaatctaagttacgtgcacaattggaaaatcaagcc
aaagataaacagcatcagcaacggtttgtggaaactgaagatgctcttgcagccatggca
gactttgagcttcctgcgaaccttcttaaagatcgcatctctatgctcacccgagaaaaa
ttactcaatgcacgtttaattgaatactgctctaatgaggagttagaatcccgcaaacaa
aaacttttaaaagaagcggaagatagtgctgtaaaggctttacgcctattatttttgacc
cgcaaaatttttgaagacgaaaagctctcctttacccgagaagaacttcaatacatgata
gaggtgtgctctagagagcgttttggccctcaaccgcctaaagacatttctaatgaaatg
ttgcaagaacttgtctccgcagctcgagatcggctgacttacagtaaagctatagaaaaa
gctcgtgaaaaagcagaaaagttagctgtaagctccttagcatag

DBGET integrated database retrieval system