KEGG   Chlamydia pecorum E58: G5S_0198Help
Entry
G5S_0198          CDS       T01466                                 

Gene name
pcnB
Definition
(GenBank) poly A polymerase
  KO
K00970  poly(A) polymerase [EC:2.7.7.19]
Organism
cpm  Chlamydia pecorum E58
Pathway
cpm03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:cpm00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    G5S_0198 (pcnB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:cpm03019]
    G5S_0198 (pcnB)
Enzymes [BR:cpm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.19  polynucleotide adenylyltransferase
     G5S_0198 (pcnB)
Messenger RNA biogenesis [BR:cpm03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Others
     G5S_0198 (pcnB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PolyA_pol PolyA_pol_RNAbd tRNA_NucTran2_2
Motif
Other DBs
NCBI-ProteinID: AEB41214
Position
205897..207129
Genome map
AA seq 410 aa AA seqDB search
MDVNALEAAKKVLVKLRNAGYQAYFVGGCVRDMLMGKPMVDIDIATDAPPVIVSTIFSDV
ISIGAAFGIIVVKLEGYLFEVATFRNDGQYTDGRHPQQVKFSSMREDALRRDFSINGIYY
DPFEDKLFDFVEGIRDIEKKVIRAIGHPRLRFAEDKLRILRAIRFASSLEFTLDPATERA
LIKEAPTLVSAVSPERIWQELKKMMKSHPYQAMVLLLKLKVLVTIFPELRDIPYGILRST
IAFLNKLNPQKFPEILLLLPLFQGVPEEATSAAFSRLKVSNKELRLIEAWYKALPHFQNI
SMSRVFWAHFLASPSASMFLEIFSALQKDPSKQQHFIARVQELETRLEKFILRIKTASPL
ISAPDLMAKGIAPGRLLGDLLKEAENLSIEHECLDKEKILAILQEKGFWK
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atggatgtcaatgcccttgaagcagcaaaaaaagtcttagtaaagttgcgtaatgcaggt
taccaagcgtatttcgtcgggggatgcgttagggatatgcttatgggcaaacctatggtg
gacatcgatattgctacggatgcgcctccagtaattgtctcgacgattttttctgacgtg
atttccataggagcagctttcggaattattgttgtcaagttagaagggtacctttttgaa
gttgcgacctttcgtaatgatggtcagtatacagatggtcgtcatccacaacaagtgaag
ttttcttccatgagggaggatgctttacgtcgagatttttccattaacggcatatattac
gatccctttgaagataagctctttgattttgtcgagggaatccgagatattgaaaaaaaa
gtaattcgcgctataggtcatcctcgcctgagatttgcagaagataaattaaggattctc
agggcaattcgtttcgcttcgtctctagagtttaccttggatcccgcaacagaaagagct
ttgatcaaagaagctccaactttagtaagcgctgtttctccagaaagaatttggcaagag
ctgaagaaaatgatgaaaagccatccctaccaagcgatggtcttgttactaaaactaaag
gttctagtgaccattttcccagaacttcgcgacatcccctacggcatcctacgctccact
atagcgttcttaaacaaacttaaccctcagaaattccctgaaatccttctattacttccc
ttatttcaaggagtcccagaggaagccacatctgccgctttttctagactcaaagtctca
aataaagaacttcgcctgatagaagcatggtacaaagcattgccacattttcaaaacatt
tctatgagcagggttttttgggcgcatttccttgcctccccttctgcctcgatgttttta
gaaatattctcagctctacaaaaggatccaagtaaacaacagcatttcattgcgcgtgtt
caagaactcgaaacacgccttgaaaaatttattttacgaataaaaacagcctctcctttg
atttctgctcccgatcttatggctaaaggcatagctcctgggaggttactcggagatctt
ctcaaagaagccgaaaatctttctatagaacatgagtgtcttgacaaggaaaaaattttg
gcgattcttcaagaaaaaggattttggaaataa

DBGET integrated database retrieval system