KEGG   Chlamydia pecorum E58: G5S_0211Help
Entry
G5S_0211          CDS       T01466                                 

Definition
(GenBank) type III secretion protein SctJ
  KO
K03222  type III secretion protein J
Organism
cpm  Chlamydia pecorum E58
Pathway
cpm03070  Bacterial secretion system
Module
cpm_M00332  Type III secretion system
Brite
KEGG Orthology (KO) [BR:cpm00001]
 Environmental Information Processing
  Membrane transport
   03070 Bacterial secretion system
    G5S_0211
Secretion system [BR:cpm02044]
 Type III secretion system
  Type III secretion core apparatus [MD:M00332]
   G5S_0211
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YscJ_FliF Spore_YhcN_YlaJ
Motif
Other DBs
NCBI-ProteinID: AEB41227
Position
224972..225964
Genome map
AA seq 330 aa AA seqDB search
MFRSSISRCFFFLFALFCCTGCNSRSLIVYGLPGREANEIVVLLVSKGVAAQKLPKAAAS
TGGGSTEQLWDISVPSAQITEALAILNQAGLPRMKGTSLLDLFAKQGLVPSELQEKIRYQ
EGLSEQMASTIRKMDGIVDASVQISFSTEEDVVPLTASVYVKHRGVLDNPNSIMASKIKR
LIASAVPGLTPENVSVVSDRAAYSDITINGPWGLTDDIDYVSVWGIVLAKSSLLKFRLIF
YFLILILFILSCGLLWVIWKTHTLILSLGGAKSLFSPTPYSTVALNSAQPTNKAPDAKDP
AEAPAEKEDAEQAKEASTDAPEGSAENEES
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgtttcgtagttctatttctcggtgctttttctttttgttcgctctgttttgttgtaca
gggtgtaatagccgatcgctcattgtgtatgggcttccaggaagagaagcaaatgaaatc
gtagttcttcttgttagcaaaggagtcgctgcacaaaagctccctaaagctgcagcctct
acgggaggaggatctacagaacagctttgggatatctctgtgccttcagcacaaattact
gaagccttggctattttaaatcaggctggtcttcctagaatgaaaggaactagtctcttg
gacttatttgccaaacaaggtcttgtcccatcagaactccaagaaaaaatccgctaccaa
gaaggcctttcagaacagatggcctctacgattcgtaaaatggatgggatcgtagatgct
agtgtgcaaatttccttctctacggaagaagacgttgtcccactcactgcctctgtttac
gtgaaacatcgtggggttttagacaaccctaacagtattatggcctccaaaatcaagcgc
ttaattgctagtgcagtccctggtctcacccctgaaaatgtttccgtggttagcgatcgc
gctgcctacagcgacattaccattaatggcccttggggattaacagatgatatcgattat
gtttccgtctgggggattgtgctagccaaatcgtcactcttaaagtttcgccttatcttt
tatttcttaattcttattttgtttatcctttcatgcgggcttctttgggtcatttggaaa
acacatactctcattctttccttgggaggagcaaaaagtttgttctcaccaacgccatac
tctactgtagcgttaaactctgcacaacccacaaacaaagctcctgatgctaaagatcct
gcagaagctcctgcagaaaaagaggatgctgagcaagctaaagaggcctcaacagatgct
ccagaaggaagcgcagaaaatgaggaaagttag

DBGET integrated database retrieval system