KEGG   Chlamydia pecorum E58: G5S_0213Help
Entry
G5S_0213          CDS       T01466                                 

Definition
(GenBank) type III secretion apparatus protein, HrpE/YscL family
  KO
K03223  type III secretion protein L
Organism
cpm  Chlamydia pecorum E58
Pathway
cpm03070  Bacterial secretion system
Module
cpm_M00332  Type III secretion system
Brite
KEGG Orthology (KO) [BR:cpm00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    G5S_0213
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:cpm02044]
    G5S_0213
Secretion system [BR:cpm02044]
 Type III secretion system
  Type III secretion core apparatus [MD:M00332]
   G5S_0213
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FliH ATP-synt_B NolV HrpE GrpE Cauli_DNA-bind Prefoldin
Motif
Other DBs
NCBI-ProteinID: AEB41229
Position
226930..227613
Genome map
AA seq 227 aa AA seqDB search
MKFFSLIHSQDDVSPNTKVLAPEAFSSLLDAEELLEHAKEDSETFLKNTEEECERLRQAA
KTQGFKDGCSEWNAQLAFLQQEIQNLRNRVRDSLVQLAVASVKKIIGKELEMHPETIVSI
ISQALKELTQNKQITIYLNPKDLQIVEQNRPELKKIVEYADTLILTTKPEVTPGGCIIET
EAGIVNAQLDVQLLALEKAFSSILKQKDPTVSESESPSSTQKEGKKE
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttttcagcctaattcattcacaagacgatgtctccccaaatacgaaggtttta
gctcccgaggcattttcctctcttctagatgctgaagagcttttagagcacgcaaaagaa
gacagcgagacctttcttaaaaacacagaggaagagtgtgagaggctacgtcaagcagct
aaaactcaggggtttaaagatggctgcagcgaatggaatgcccagttagcttttcttcag
caggaaattcaaaatttgcgcaaccgcgtgagagattctttagtgcagctagcggttgcg
agcgtaaaaaagattatagggaaagagttggaaatgcatccagaaactattgtttctatc
atttctcaagcactcaaagagctcacccaaaataaacagattactatctatctcaatccc
aaagaccttcagattgttgaacaaaaccgccctgagttgaaaaaaattgtggagtatgcc
gatacattaattcttacgaccaagcctgaagtaaccccaggaggatgtattatcgaaacg
gaagcggggattgtaaatgcgcagcttgatgtacaattactcgccctcgaaaaggctttc
tcctctatattaaaacaaaaagaccccactgtaagtgagtcagaatctccctcttctact
caaaaagaggggaaaaaagaataa

DBGET integrated database retrieval system