KEGG   Chlamydia pecorum E58: G5S_0214Help
Entry
G5S_0214          CDS       T01466                                 

Definition
(GenBank) type III secretion apparatus protein, YscR/HrcR family
  KO
K03226  type III secretion protein R
Organism
cpm  Chlamydia pecorum E58
Pathway
cpm03070  Bacterial secretion system
Module
cpm_M00332  Type III secretion system
Brite
KEGG Orthology (KO) [BR:cpm00001]
 Environmental Information Processing
  Membrane transport
   03070 Bacterial secretion system
    G5S_0214
Secretion system [BR:cpm02044]
 Type III secretion system
  Type III secretion core apparatus [MD:M00332]
   G5S_0214
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FliP MNHE
Motif
Other DBs
NCBI-ProteinID: AEB41230
Position
227629..228546
Genome map
AA seq 305 aa AA seqDB search
MRIVFRTLLCIFACSAPWCVAHADVSSVSCPSRCDSSPLPPSQDLPAPVIEKKPLPMPSY
RLPVSADDVLPREGLSEGSFSDTYPDLTTQAVILIFLALSPFLVMLLTSYLKIIITLVLL
RNALGVQQTPPSQVLNGIALILSIYVMFPTGAAMYKDAKKEIEANTIPRNLFTAEGAETV
FVAFNKSKEPLRNFLIRNTPKAQIQSFYKISQKTFPAEIREHLSATDFVIVIPAFIMGQI
KNAFEIGVMIYLPFFVIDLVTANILVAMQMMMLSPLSISLPLKLLLVVMVDGWTLLLQGL
MISFK
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatcgttttccgaactctcctttgtatttttgcctgtagtgctccgtggtgcgta
gctcatgcagatgtttcatcggtatcctgcccttctcgttgtgactcgtctcctttgccg
ccatcacaggatcttcctgctcctgtgatagagaaaaaaccgctacccatgccctcctat
cggcttccagtatctgcagatgatgtactccccagagaaggattatctgaggggagtttc
tccgacacctatcctgacctcacaacgcaagcagttattctgattttcttagcattatcg
cccttcttggtcatgctgctcacgtcatatttgaaaatcatcattaccctagtactgtta
agaaacgccttaggagtgcagcaaactcctccgagccaagtgctcaatggtatcgctctt
attctttctatttatgtgatgttccctacaggagcagccatgtataaagatgcaaaaaaa
gaaatcgaagcgaacactattcccaggaatttatttactgcagaaggtgcagagactgtt
tttgttgcctttaacaaatctaaggagccgttgagaaactttttaattcgcaatacccca
aaggctcaaattcaaagtttttataagatttcacaaaagactttccctgcagaaattcgt
gaacatctctctgcaacagactttgtaatcgtgattcctgcatttattatggggcagata
aaaaatgcttttgaaattggagtcatgatctacttaccttttttcgtgattgacttagtc
actgcaaatatccttgtagcgatgcaaatgatgatgctttctcccctctcgatttctctc
cctttaaagttgcttcttgttgtcatggtagatgggtggacattgcttcttcaaggtctt
atgattagttttaaatag

DBGET integrated database retrieval system