KEGG   Chlamydia pecorum E58: G5S_0217Help
Entry
G5S_0217          CDS       T01466                                 

Definition
(GenBank) conserved hypothetical protein
Organism
cpm  Chlamydia pecorum E58
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2207 Choline_transpo DUF2516
Motif
Other DBs
NCBI-ProteinID: AEB41233
Position
complement(229792..230256)
Genome map
AA seq 154 aa AA seqDB search
MADEAPKKDPSNEPSSQISGIKKKVKDLHMNPKVHSMKHFFMRHAREIIGGALLLFGIIS
DFVSWIGGAFVACGIVLGFYKDIRLALANMQYYYNKNGPIKNALLCGLLLFFMMNMFTFV
VAFLLLCVILIFIMDARPPVESQEHHHLSDHHQQ
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggcagatgaggccccaaaaaaagatccttctaacgagccttcttcgcagatttctggc
attaagaaaaaagttaaggatttgcatatgaaccccaaggtgcatagtatgaagcatttt
ttcatgcgtcatgcacgggagattatcggaggagctctgttgcttttcgggattatctcg
gattttgtttcttggatagggggagcttttgttgcttgtgggattgtcttagggttttac
aaggacatccgcctagccttggccaatatgcagtattactataataaaaacggccctatt
aaaaatgctcttctttgtggattattgttatttttcatgatgaacatgttcacatttgtt
gtggcatttttgcttctttgcgtaattcttattttcattatggatgcgcgtccccctgta
gagagccaagaacatcaccacctctcagatcaccatcaacagtaa

DBGET integrated database retrieval system