KEGG   Chlamydia pecorum E58: G5S_0218Help
Entry
G5S_0218          CDS       T01466                                 

Definition
(GenBank) conserved hypothetical protein
Organism
cpm  Chlamydia pecorum E58
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AEB41234
Position
complement(230344..231348)
Genome map
AA seq 334 aa AA seqDB search
MQPYIFTLLCLASLASLVAFDAANARKYSAYAQTIENHENFLTVRRAACAEVEYQEKLKK
LAPIQKLPKDKETSTPNKVAQVATRKKQRYRLLKVPFSRPPNNSRYNLYALLTESPEEYN
NPSSWYAIFVRLLKRAYVDPGIVPQGAEYAITNLLLSKKEEILEGASKYGPDILETLTLP
TEEAEIFYTMLKGSPHAQSLLNFLHYEEKSLGECKLNLIFMDPLLLEAVINHPLGCQELQ
SLRDGIWDAVKTQEEAIQQHGQAAALELFKTRTDFRLELRDKTQIILNQHGLVELLNKKL
FDFTLGSAGDYLFLIDPQTKVVSRCRCSSKSSKL
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgcagccgtatatttttactttactatgtcttgcatcgcttgcttctttggttgccttt
gatgctgctaacgcacgtaaatactctgcatatgcacagactatagaaaaccatgagaat
ttcttaacagtacggcgtgctgcttgtgccgaggtagagtatcaggaaaagctaaaaaag
cttgcaccgatacaaaagctccctaaggataaagaaacttctactcctaacaaagtagca
caagttgccacaaggaaaaaacagcgctatcgcttattaaaagtgcccttttctagacct
ccaaataactccagatataacctatatgctttgcttacagaatcccccgaggagtataac
aacccctcatcatggtatgcgatttttgtaaggcttttgaaacgagcttatgtggaccct
gggatcgttcctcagggagcagagtatgccatcacgaaccttcttctgagcaaaaaagaa
gaaatcctagagggggcctctaaatatggccctgatattcttgagaccctaacactccca
accgaagaggcggaaatcttttatacgatgttaaaaggatctccgcatgcgcagtcttta
ttgaacttcctccattatgaagagaaaagcttgggggagtgcaagctcaacctgattttt
atggatcctctattattggaggcggtcattaaccaccccttgggatgtcaggaacttcaa
tccttgcgtgacggaatttgggatgccgttaaaacccaagaagaagctatccaacagcac
gggcaagccgcagctctggagctctttaaaacccgtacagattttcgcctcgagcttagg
gataaaactcagatcatccttaaccagcacggtttagtagaactgctaaataaaaagctc
ttcgattttaccctagggagtgccggagattacttatttcttatagatcctcaaactaaa
gtagtttcccgctgccgttgttcttcaaagagctcaaaattataa

DBGET integrated database retrieval system