KEGG   Chlamydia pecorum E58: G5S_0223Help
Entry
G5S_0223          CDS       T01466                                 

Gene name
pilC
Definition
(GenBank) general secretion pathway protein F
  KO
K02455  general secretion pathway protein F
Organism
cpm  Chlamydia pecorum E58
Pathway
cpm03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:cpm00001]
 Environmental Information Processing
  Membrane transport
   03070 Bacterial secretion system
    G5S_0223 (pilC)
Secretion system [BR:cpm02044]
 Type II secretion system
  General secretion pathway protein [MD:M00331]
   G5S_0223 (pilC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T2SSF Virul_fac_BrkB
Motif
Other DBs
NCBI-ProteinID: AEB41238
Position
complement(232739..233914)
Genome map
AA seq 391 aa AA seqDB search
MPRYAYTYLDSREKKRRSFLEAAHLQEAQEKLMQQGVQVLGIREAPPSRIRIKNTELIVL
TKQLALLLRSGLPLYESLASLRDQYQGQGIATLLSSFMDVLRSGGALSEAMAVHPEIFDN
FYCSAVIAGENVGALEECLNNVVTVLEERAHISKKLLAALSYPLILLSFSIMVILFFLLG
VIPSLRESFENIEPNRLTTIVFGLSECLCTYKLTIALGLGGGIGIGMAFRRKIPWKRFFE
KCCFAFPFVKKFLVKVALIRFCSVASAILKGGGTLIEGLELGYGAIPYEGIRDEMKLMVK
AVTQGSSLSEEFAQRPWVPKLALGMVSLGEESGELAEVLGYVARMYNEDVQKTLSCLTSW
CQPVILILLGGIIGVIMLAILIPLTSNIQAL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgccaagatatgcttatacctatcttgactctagggaaaaaaaaagacggagtttttta
gaggctgctcatcttcaagaagcacaggagaagcttatgcagcagggagtccaagtatta
ggtatacgagaagctccccccagtcgtatccgtattaagaatacggagttgattgtcttg
acgaagcaacttgcgttactgctgcgctcgggattgcctctatatgaaagcttagcttcc
ctgagagatcaatatcaagggcaggggatagcaacattgttatcttcgtttatggatgtg
ttgcgctcgggaggagcattatctgaagctatggctgtacatccggagatatttgataac
ttttattgtagtgctgtcatagctggggagaacgtcggagctttggaagagtgtttgaat
aacgttgttactgtattggaggagcgcgcgcatatctcaaaaaagctcttggcagccttg
agttatcccctgattttattgagcttctccattatggtgattttattttttctcctaggg
gtgattccttcgttgagggagagttttgaaaatatcgagcccaacaggttaactacgatt
gtatttggtttgagtgagtgtttatgtacttataagctcacaatagctttgggtttagga
ggcggaatagggatcggcatggcatttcgcagaaagatcccctggaagaggttctttgag
aagtgttgttttgccttcccctttgtgaagaagttcttagtcaaggtagctttgatacgc
ttttgctctgtagcttcagcaattttaaaaggaggaggcaccctaatagaaggcttggag
ctgggctatggagccatcccttacgaagggattcgtgatgaaatgaagttgatggtaaag
gcagtgacccaggggagttctttgagcgaggagttcgcacaaagaccttgggttccaaaa
cttgccttaggcatggtatccctaggggaagagtctggagagcttgctgaagtattgggg
tatgttgcccgtatgtacaatgaggatgtgcaaaaaaccctttcttgcctaacctcatgg
tgtcagccggtcattcttatacttttaggggggattattggggtaatcatgctggcgatc
ctcattcctctcacaagtaatatacaagcgttgtaa

DBGET integrated database retrieval system