KEGG   Chlamydia pecorum E58: G5S_0225Help
Entry
G5S_0225          CDS       T01466                                 

Definition
(GenBank) Bacterial type II and III secretion system protein
  KO
K02453  general secretion pathway protein D
Organism
cpm  Chlamydia pecorum E58
Pathway
cpm03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:cpm00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    G5S_0225
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:cpm02044]
    G5S_0225
Secretion system [BR:cpm02044]
 Type II secretion system
  General secretion pathway protein [MD:M00331]
   G5S_0225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Secretin Secretin_N
Motif
Other DBs
NCBI-ProteinID: AEB41240
Position
complement(235409..237664)
Genome map
AA seq 751 aa AA seqDB search
MRFFYSSIAYILGMTGCVSPLAALTIAEKMHSLEEHEVSTDAYAGMASFNLDMKESSLRL
KQIYEEAANLRAAGCEEAQVWQELLSRLSQVKRHLREIEMLWAEEVRDKNENFEEYALWH
HPEATIYNLVADYGEECIYLVPQDIGMMKVSAFSKLVVPKESFEHCLTLILSRLGIGIRQ
VNPWIKELYFHREGSGVAGVVASKQELECLPSTARIGFILGSKNIDVRAELQLLRKFINI
DTTQIEIIAGHLWVFGTVGEITELLKVYEFIQKDNVRQEYRIVPLNKIDAKEMLEILNAA
FREDVTKEDREDSVGLRVVPLQYQGKALFLRGSAALVQQAVTLIRDLEEGIESPSDKTVF
WYHVKHSDPQELAVLLSQVHDAFSGETSSSQGKAEISMAKASPLVQIDTSSGVPMKEGPV
KYGNFIADSKTGTLVMVVEKEALSRIQMLLKKLDVPKKMVRIEVLLFERKLSHDRKSGLN
LLRLGEEISKKSLTPTVSWGSGAGILEFLLKGATGCSIVPGYDLAYQFLMAQEDVRINAS
PSVVTMNQTPARIAIVDEMSIAVSAENDKALYNRAQYGIMIKMLPVINVGEEDGKSYITL
ETDITFDTTGKNMDDRPEVTRRNITNKVRIADGESVIIGGLRCKHMSDSQEGIPFLGEIP
GLGKLFSMNAVSDSLTEMFVFITPKILDNPMEKQERYEEALLASRPGEDEEFYQALVASE
AVARSAQQKLKMRSMMGFPSPLVEDLEYDGR
NT seq 2256 nt NT seq  +upstreamnt  +downstreamnt
atgagatttttttatagctctatagcctatattttagggatgactggctgcgtgtctccg
ttggctgcgctgacgattgcagagaagatgcactctttagaagagcatgaggtctccaca
gatgcatatgcagggatggcttcttttaatcttgatatgaaagagagttctcttcgctta
aaacagatttatgaagaggctgcaaacttaagagcagcgggatgtgaagaggctcaggta
tggcaggagcttttatctaggctttctcaagtaaagcgtcaccttcgagaaattgaaatg
ctttgggctgaagaagtccgagacaagaatgaaaatttcgaggagtatgctttatggcat
caccccgaagccacgatttataatcttgttgcggattatggtgaggagtgtatctacctt
gtccctcaagatattggtatgatgaaagtctcagcattttcaaagcttgtcgttcctaaa
gagagctttgagcattgtctgactctgattctttcgcgtttaggcattggaatacgtcag
gtaaacccatggatcaaggagctttattttcatagggagggctctggagttgctggagtg
gtagcttctaagcaggagctagaatgtttgccttccactgcccgcatcgggtttatcttg
ggttctaagaatatcgatgtacgcgcagagctacaactgttacgtaagtttatcaatata
gatacgacacaaattgagattattgctgggcatctgtgggtttttggaactgtaggggag
attacagagcttctgaaggtgtatgagtttatccaaaaggataacgttcggcaggagtac
cgcattgttcccctaaataagattgacgcgaaggaaatgctagaaattttaaatgcggcc
tttcgtgaagatgttaccaaagaagatagagaagattctgtagggttgcgtgtagttccc
ttgcaatatcagggaaaagcgcttttcttacgaggttctgcagctctcgtacagcaggcc
gtgacgttgatacgagatcttgaggaaggcatagaaagtccttcggataagactgtgttt
tggtatcacgtgaagcactccgaccctcaggaacttgcagtgctgctttctcaggtccac
gatgccttttctggagaaacctcttcctcacaaggaaaagcggaaatctctatggcgaag
gcgtctccgctagtgcagatagatacttcttcgggggttcctatgaaagaggggcctgta
aagtatggaaactttattgcggactcaaagacaggcacgttagtcatggtggtagagaaa
gaggctctatcgcgaattcagatgttgcttaagaagctcgatgttccgaagaagatggtc
cgtatcgaagtgctgctttttgaaagaaagctttctcacgataggaaatccggattaaac
ctgctgcgtttaggggaagagattagcaaaaaaagtttaacccccacggtttcttggggt
tcgggagcagggattttagaatttttactcaagggtgcaacgggatgttccatagtcccg
ggatatgaccttgcctatcaatttttaatggctcaagaagatgtccgtattaacgcgagt
ccttcagttgtgacgatgaaccaaacgccggcaagaattgccattgtggatgagatgtct
attgcggtgtctgcggaaaacgacaaagctctgtataatcgggcgcaatacggaattatg
attaagatgcttcctgtgattaacgtcggggaagaggatgggaagagctatattaccctg
gaaacggacatcaccttcgatacaactgggaagaacatggatgaccgtcccgaggtgacg
cgtcgtaatattactaacaaggtgcggatcgcagatggagaatctgtaattattggaggt
ttgcgctgtaaacacatgtctgactctcaggaggggattccttttcttggagagatccca
gggcttgggaagttgtttagcatgaatgctgtctcggatagccttacggaaatgtttgtt
ttcatcacgccgaagatcttagacaaccctatggaaaagcaagagcgctatgaggaggct
ttgctcgcctctcgtccaggggaagatgaagagttctatcaagctttagttgcgagtgag
gctgtagcacgttctgcacagcagaaactaaagatgcgctccatgatgggcttcccttca
cctctagtggaggacttagagtacgatggccgatga

DBGET integrated database retrieval system