KEGG   Chlamydia pecorum E58: G5S_0229Help
Entry
G5S_0229          CDS       T01466                                 

Definition
(GenBank) type III secretion low calcium response chaperone LcrH/SycD
Organism
cpm  Chlamydia pecorum E58
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ANAPC3 TPR_16 TPR_19 TPR_2 TPR_3 Ipi1_N
Motif
Other DBs
NCBI-ProteinID: AEB41244
Position
242088..242816
Genome map
AA seq 242 aa AA seqDB search
MSNPTGKSSGKSNQTYKPSASFNKKNRSRLAELAAQKKANEDNLEQKYPIPTEEETKQAM
VNILEGLSNGLTLQQILGISDVLLEEIYTISYSLYSQGKYLEAVGLFQVLVASKPQCYKY
MLGLSSCFHQLKLYNEAAFGFFLAFDAQPENPIPPYYIADSLLKLDQLDEAQNFLDITTD
ICKDKPEYKILKERCNIMKQSIAKQREEEEKAASSTKASSTTTKKAKAPSKKKNDSKKGK
KK
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatcctactggcaaatcgagcggcaaatcgaaccagacttacaaaccttcggcg
tcatttaacaaaaaaaaccgcagtcggttagcggagcttgcggcccagaaaaaagcgaat
gaggacaacttagagcaaaagtatccgattcctacagaagaagagacgaagcaagcgatg
gtcaacatcttagaaggcttgagcaatgggttaaccttacaacagatcttggggatttct
gatgttctcttagaggaaatttacactattagctacagtctgtattcccaaggaaagtac
cttgaggctgtagggttattccaagtacttgttgcatcaaagccgcagtgctataagtac
atgttaggattaagctcatgcttccatcaactcaagttgtataatgaggctgcctttgga
tttttcctagcctttgatgcacaacctgaaaacccaattcctccttattacattgcagat
agtcttcttaagctcgaccaattagacgaagcacaaaatttcttagatatcactacagat
atttgtaaagacaagcccgagtataaaatacttaaagagcgctgcaatattatgaagcaa
tccattgcaaaacagcgggaagaagaagaaaaagcagcttcttcaacaaaagcaagttca
acaacaacaaaaaaagccaaagctcctagcaaaaagaaaaatgattctaagaaaggcaag
aaaaaatag

DBGET integrated database retrieval system