KEGG   Chlamydia pecorum E58: G5S_0236Help
Entry
G5S_0236          CDS       T01466                                 

Definition
(GenBank) CobQ/CobB/MinD/ParA nucleotide binding domain protein
  KO
K03496  chromosome partitioning protein
Organism
cpm  Chlamydia pecorum E58
Brite
KEGG Orthology (KO) [BR:cpm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cpm03036]
    G5S_0236
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:cpm04812]
    G5S_0236
Chromosome and associated proteins [BR:cpm03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    G5S_0236
Cytoskeleton proteins [BR:cpm04812]
 Prokaryotic cytoskeleton proteins
  MinD / ParA class of bacterial cytoskeletal proteins
   G5S_0236
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_31 CbiA CBP_BcsQ ParA MipZ Fer4_NifH VirC1
Motif
Other DBs
NCBI-ProteinID: AEB41251
Position
249099..249866
Genome map
AA seq 255 aa AA seqDB search
MQTIAVNSFKGGTAKTSTTLHLGAALAQYHHARVLLIDFDAQANLTSGLGLDPDCYDSLA
VVLQGEKDIHEVIRPIEDSDVDLIPADTWLERVEVSGNLAADRYSHERLKHILKEVESDY
DYVIIDTPPSLCWLTESALIAADHALICATPEFYSVKGLERLAGFIQGIAARHPLTVLGV
ALSFWNCRGKNNATFAQLIQKTFPGKLLETKIRRDITISEAAIYGKPVFATAPSGRASED
YLKLTKELLTLLKDV
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacaattgctgtaaacagttttaaaggaggaactgccaaaacatcaaccacgttg
catctaggagcagctttagctcaatatcatcacgctagagtattgcttattgattttgat
gcccaagcgaaccttacctcagggctaggcttagaccctgactgttatgatagcttggca
gtagtattgcaaggcgaaaaggacattcatgaagtgatccgcccgattgaggattccgat
gtggatttaatccctgcggatacgtggttggagcgggttgaggtctcaggaaatcttgct
gcagaccgctactctcatgaacgcctaaagcacattcttaaagaggtggagagcgattat
gactatgtcataatcgacactcctccctctttatgctggcttacagaatccgcgttgatt
gctgctgatcatgcattaatctgtgccaccccagaattttatagtgtaaagggtttagaa
cggctagcaggattcattcaaggaatcgctgcacgccatcctttaacagttctgggagtg
gcattatctttttggaactgtagaggaaaaaacaatgcaacgtttgctcaactgatccaa
aaaactttccctggaaaacttctcgaaaccaaaatccgcagggatattacgatttctgaa
gcggcaatttatggaaagcccgtatttgccacagcaccgagtgggcgagcttccgaagat
tacctgaaattgacaaaagagctactaaccttattaaaagacgtgtaa

DBGET integrated database retrieval system