KEGG   Chlamydia pecorum E58: G5S_0241Help
Entry
G5S_0241          CDS       T01466                                 

Gene name
uvrB
Definition
(GenBank) excinuclease ABC, B subunit
  KO
K03702  excinuclease ABC subunit B
Organism
cpm  Chlamydia pecorum E58
Pathway
cpm03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:cpm00001]
 Genetic Information Processing
  Replication and repair
   03420 Nucleotide excision repair
    G5S_0241 (uvrB)
DNA repair and recombination proteins [BR:cpm03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     G5S_0241 (uvrB)
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     Supressor
      G5S_0241 (uvrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Helicase_C UvrB ResIII DEAD UVR AAA_30 AAA_22 Microtub_bd Endonuc-dimeris
Motif
Other DBs
NCBI-ProteinID: AEB41255
Position
252205..254196
Genome map
AA seq 663 aa AA seqDB search
MAGFAEFLSMTFHLHSPFQPCGDQPEAIAKLCSGLKENVRAQVLLGATGSGKTFTIANVI
AQANLPTLVLAHNKTLAAQLYQEFREFFPENAVEYFISYYDYYQPEAYIARSDTYIEKSL
LINDEIDKLRLSATRSILERRDTLIVSSVSCIYGIGSPENYLSMTLELQVGKAYPRDLLT
SQLAKMHYQASPLPQRSAFRELGSVLDVFPAYENQALRLEFANDTLVSIDICDPLTMLPQ
SSTTQTILYPGSHYVTPEAIREYAVRSIREELEERLKFFETRPVEQERLFQRTTHDIEMI
KEIGFCKGIENYSRHFTGAPPGAPPACLLDYFPEEFLLIVDESHQTLPQIRAMYRGDRSR
KEALVEYGFRLPSAFDNRPLTYEEAQKYFRKVIYVSATPGDTELKKSQGHIVEQILRPTG
IPDPLPEIRPATGQVDDLLEEIRVRLAKTHEKILVISLTKKLAEEIAVFLNELEIPAAYL
HADIETAERTHILADLRTGKIDVLIGVNLLREGLDLPEVSLVAILDADKEGFLRSTSSLI
QFCGRAARNVHGKVIFYADKKTPAIEATLKEAARRRQIQIAYNKKHNLTPRPIIKAVFSN
PIPQGTKKDPFPQEQELSQEELEKLIKKNEKLMLLAAEEFRFEDAAKYRDLIHSYKKRLL
ELS
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atggcgggctttgctgaattcctctctatgacgtttcaccttcattctccttttcaacca
tgtggagaccaacctgaagccattgcaaagctatgctctgggttaaaggagaatgttcgt
gctcaagtgcttctaggagcaacaggttcagggaaaacatttaccatagcgaatgtgatt
gcccaagcaaacctccctacactggtattagcccataataagacactagcagctcagctc
tatcaagagttccgggagttctttcctgagaatgctgtcgaatacttcatttcgtattat
gactattatcagcctgaggcgtatattgcccgtagtgacacctatatagaaaaaagctta
ttaatcaatgatgagattgataagttgcgcttatctgcaacacgttcaattttagagcgt
cgtgacaccttaatagtctcttctgtttcctgtatttatggtataggctctcccgaaaat
tatctttctatgacgttagaattacaggtcggaaaggcataccctagggatcttcttacc
tcacaattagcgaaaatgcattatcaagcctctcctcttccccagcgcagtgcttttcga
gaactcggaagtgtactagatgttttccctgcctatgaaaatcaagctcttcggctagag
tttgctaacgatactctagtctctatcgatatttgtgatcccctgacaatgctccctcag
agctcaacgacacaaacaatactttaccccggatcacattatgttacacctgaagcaatt
cgagaatatgctgtacgctctatccgagaagaactggaagaacgcctgaagtttttcgaa
acacgccctgtagaacaagaacggttatttcaaagaaccacgcatgatatcgaaatgatc
aaggaaattggcttttgtaaagggatcgaaaattactctcgtcatttcacgggagctccc
cccggagcaccgccagcatgcctgctggattatttccctgaggagtttttactcatagtg
gatgagtcccaccaaacacttccacaaatacgtgcaatgtatagaggagatagatctcga
aaagaagccttggtagaatatggttttcgtttgccttccgcatttgataaccgtcccctt
acctatgaagaagctcagaaatacttccgcaaggtgatctatgtttctgcaactcctgga
gacacagagctcaaaaaaagccaagggcatattgttgaacaaattcttcgtcctacaggg
atcccagatccccttccggaaattcggcctgctacagggcaagttgatgacctcctagag
gaaatccgcgtaagattagcaaaaacacatgagaaaatcttagtaatctccctaacaaaa
aagcttgcagaagagatcgcagtgtttctcaatgagctggagattcccgcagcctacctc
catgcagatatagaaactgccgagcgtacccacatcttagccgatctacgcacagggaaa
atcgacgtgctcattggagtcaacctccttcgtgaagggctggatcttcctgaagtatct
ttagttgccattttagatgcagacaaggaaggctttttgcgcagcacttcctcactcatt
cagttttgtggcagagctgcaaggaacgttcatgggaaagtaattttctacgcagataaa
aaaactcctgctatcgaagcgactctgaaagaagctgcccgccgcaggcagatccaaatt
gcgtacaacaaaaaacataacctcaccccccgccccatcatcaaagcagtcttttccaat
cctattcctcaaggaacaaaaaaagatccttttccccaagaacaagagctctcccaagag
gagctagagaaactcattaagaaaaatgaaaagctcatgcttcttgctgctgaagagttt
cgtttcgaagatgcagcaaaataccgtgatctcatccactcgtacaaaaagcgacttcta
gagctctcctaa

DBGET integrated database retrieval system