KEGG   Chlamydia pecorum E58: G5S_0242Help
Entry
G5S_0242          CDS       T01466                                 

Gene name
eno
Definition
(GenBank) enolase
  KO
K01689  enolase [EC:4.2.1.11]
Organism
cpm  Chlamydia pecorum E58
Pathway
cpm00010  Glycolysis / Gluconeogenesis
cpm00680  Methane metabolism
cpm01100  Metabolic pathways
cpm01110  Biosynthesis of secondary metabolites
cpm01120  Microbial metabolism in diverse environments
cpm01130  Biosynthesis of antibiotics
cpm01200  Carbon metabolism
cpm01230  Biosynthesis of amino acids
cpm03018  RNA degradation
Module
cpm_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cpm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    G5S_0242 (eno)
  09102 Energy metabolism
   00680 Methane metabolism
    G5S_0242 (eno)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    G5S_0242 (eno)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:cpm03019]
    G5S_0242 (eno)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cpm04147]
    G5S_0242 (eno)
Enzymes [BR:cpm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.11  phosphopyruvate hydratase
     G5S_0242 (eno)
Messenger RNA biogenesis [BR:cpm03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     G5S_0242 (eno)
Exosome [BR:cpm04147]
 Exosomal proteins
  Proteins found in most exosomes
   G5S_0242 (eno)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Enolase_C Enolase_N MR_MLE_C MAAL_C
Motif
Other DBs
NCBI-ProteinID: AEB41256
Position
254317..255597
Genome map
AA seq 426 aa AA seqDB search
MCDATISNIQAREVLDSRGYPTVAVKVITNLGTFGEACVPSGASTGVHEALELRDHDASR
YQGKGVLQAVKNVKEVLLPLLHGYSVFDQILLDSMMVDADGTPNKSKLGANAILGVSLAS
AKAAAATLKRPLYRYLGGCFASTLPCPMMNLINGGMHADNGLEFQEFMIRPIGAHSMHEA
VSMGADVFHALKNLLKSRHLATGVGDEGGFAPNLRSNAEALELLMTAIEAAGFVPGEEVS
LALDCAASSFYEAVTKTYHGRPYDAQIEILKELCERFPIDSIEDGLAEEDYEGWEKLTQE
LGDQVQLVGDDLFVTNPGLIAEGISKNLANAVLIKPNQIGTLTETSEAIQLAHSHGYSTI
LSHRSGETEDTTIADLAVAFSTGQIKTGSLSRSERIAKYNRLLAIEEELGQESLFKDSNI
FASYEE
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgacgccaccatttccaatatccaagcgcgagaagttctagattctcgaggctac
ccgacagtagctgttaaagtcattaccaacttgggaacttttggagaagcatgcgttcct
tctggagcttctacaggagtccatgaagctttggaactgcgcgatcacgatgcttctaga
tatcaagggaagggagtactacaagcagtaaaaaatgttaaagaagttcttcttcctctg
ctacatggctatagcgtctttgatcagatccttttggattctatgatggtagatgctgac
ggcacaccaaataaatcaaaattaggagccaatgcgattctaggggtttctttagcgtca
gcgaaagcagcagcagcaactctgaagcgtcctctatatcgctatctcggagggtgcttt
gcctctacccttccttgccctatgatgaaccttatcaatggcgggatgcacgcagataat
ggcctggaatttcaagaatttatgatccgtccgattggggcgcactctatgcacgaggcg
gtatctatgggggcggatgtattccatgctttgaaaaacctcttaaagtcacgtcattta
gctacaggagtaggcgatgaaggaggctttgctccgaacttacgctccaatgcagaagct
ttagagcttctcatgactgcaatagaagccgcaggttttgtccctggggaggaagtttct
ttagctctagattgcgcagcatcttctttttacgaagcagtgacaaaaacctatcacggc
agaccttatgatgcacagatagagattcttaaagagctttgcgaacggtttcctatagac
tctattgaggatggcttagcggaggaagattatgaaggatgggagaaattaacccaagag
ctcggcgatcaagttcaacttgttggagatgatttatttgtaaccaatcctggtttaata
gccgaagggatcagtaaaaatcttgccaatgcggtattgattaagccaaatcagatcgga
acactcacagaaacttctgaggcgatacagcttgcccattctcatggatatagcactatt
ctctcacaccgctctggggaaactgaagatactaccattgcagatcttgctgtagcattt
tccacaggtcagataaaaacaggatctttatcacgttctgaacgcatcgccaaatataac
aggctcttagcaatagaagaagagctcggtcaggaaagtctctttaaagattccaatatt
tttgcctcttacgaagaatag

DBGET integrated database retrieval system