KEGG   Chlamydia pecorum E58: G5S_0243Help
Entry
G5S_0243          CDS       T01466                                 

Definition
(GenBank) regulatory protein
  KO
K07315  phosphoserine phosphatase RsbU/P [EC:3.1.3.3]
Organism
cpm  Chlamydia pecorum E58
Brite
KEGG Orthology (KO) [BR:cpm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:cpm03021]
    G5S_0243
Enzymes [BR:cpm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.3  phosphoserine phosphatase
     G5S_0243
Transcription machinery [BR:cpm03021]
 Prokaryotic type
  Bacterial type
   Other transcription-related factors
    RNA polymerase-associated proteins
     G5S_0243
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SpoIIE HAMP
Motif
Other DBs
NCBI-ProteinID: AEB41257
Position
255689..257602
Genome map
AA seq 637 aa AA seqDB search
MIPFTKTIGFRLWLACVTAIIVPLGINIVLLNLGQYHSTVKSISTALRENTAFKANTFMQ
IVPLNSDVLSLFSEVLQLNKGVPNAPDWALSNEMQKIFHQTYDEISLIKIQENGEKIVVA
SSLPEHLGKNYNDNITITPDKTLLASFKRGETSDEMFTVMQLNLFDPKTQDLQGIIYTTF
NAKDLLKNFMINQQDYLTIKTAILSKHGVILKASDPALNLRRISPNISQEEFCQGFLNHD
LCTKTLYLEPLQLHPLPSIGENFFSFTIKNKEMWGYMEDLPSMDISILSYSQKSLSFSPL
WKEVVVSFAYFFFILFGSFLAFLVAKRLSLPIRKLATTMIATRKTLKYPPYTEDSLGFEI
NRLGEIFNAMVDNLEKQQELAKKNFLLKENAQNALQLGEQAQQRLLPNALPSAPDVQIAK
AYIPAVTVGGDFFDVFTLGEGHNAKLFLIVADASGKGVNACGYSLFLKNMLRTFLSHSSS
LKEAIEKTSSLFYENTADSGMFVTLCVYSYSYASQTLEYYSCGHNPACYVTPQGESCLLF
HQGMALGFLPTIAKASSILFHPQPGSLLILYSDGITEAHNAQQEMFGEERLLALARTLTN
KTAEEAVHALMLAVKTFVGNQPQHDDITLIILKILAS
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgattccttttactaaaactattgggttccggttatggttagcgtgcgtaactgcaatc
attgttcccttggggatcaatattgtcttgcttaacctagggcaataccactctacagta
aaatccatctccacggcactaagggaaaatactgcatttaaagccaatactttcatgcaa
attgtccctttaaattcggatgtcctttctttgttctccgaggtattgcagttaaataaa
ggtgttcctaacgctccagattgggctttaagcaatgaaatgcaaaagatctttcatcag
acctatgatgagatctccctgatcaaaattcaagaaaacggagagaaaatcgttgttgcg
tcgagtctccccgagcatttggggaaaaattacaatgacaacatcaccatcactccagac
aaaacgctcttagcttcgtttaagcgtggggagacttctgatgagatgtttactgtgatg
caattgaacctcttcgatcctaaaactcaagatcttcaagggattatatatactacattt
aatgctaaagatctcttaaagaacttcatgatcaaccaacaggactaccttacaataaaa
actgcgatcctatctaagcatggggtgatcctcaaagcttcagatcctgctctaaatctt
agaaggatctctcccaacatttcccaagaggagttttgccaggggtttctgaatcatgat
ctctgcacgaaaactttgtacttagagcctcttcagcttcaccctcttccttccattgga
gaaaattttttctcttttaccatcaaaaataaagaaatgtggggctacatggaagacctc
cctagtatggacatttctattctatcttacagccaaaaaagcctaagcttctccccctta
tggaaagaagtagtcgtgtcttttgcctactttttctttatcctctttggaagcttctta
gcgttccttgtggccaagaggctctctttacctatccgcaagctcgcaacaaccatgatt
gccacaagaaaaaccctaaaatatcccccctacactgaagattccctagggtttgagatt
aatcgcttaggggagattttcaacgctatggtggataatttagaaaaacagcaagagctc
gcaaaaaaaaatttcctccttaaagaaaatgcccaaaatgctcttcagctaggagaacaa
gcccaacaaaggcttctccctaatgctcttccctcagctccagatgtacaaatagctaaa
gcttacattcccgcggttactgtagggggagacttcttcgatgtatttaccctaggggaa
gggcataatgctaaactctttttgatcgttgcagatgcttcggggaagggtgtcaacgcc
tgtggatattcactattcctgaaaaatatgctgcgaacttttctttcacattcctcctcc
ttaaaagaagctattgaaaaaacttcctctcttttttatgaaaataccgcagattccggg
atgtttgtcaccctatgtgtctatagctacagctacgcttcgcaaactctagagtactat
tcctgcggccacaatcccgcctgttacgtcaccccccaaggagaatcctgcttgctcttt
catcagggcatggcattaggattcctccccaccatagctaaagcttcatccatcctcttc
cacccccaacctggatctcttcttattctctattctgatgggattactgaagctcataat
gcccagcaagaaatgttcggagaggagaggttattagctctcgctcgcacactgacaaac
aaaaccgctgaagaagcagttcatgctcttatgcttgctgtaaaaacttttgtaggcaac
cagccccaacacgacgatattaccctgattattcttaagatactcgcatcatga

DBGET integrated database retrieval system