KEGG   Chlamydia pecorum E58: G5S_0245Help
Entry
G5S_0245          CDS       T01466                                 

Definition
(GenBank) conserved hypothetical protein
Organism
cpm  Chlamydia pecorum E58
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dCache_1 SpoIIE
Motif
Other DBs
NCBI-ProteinID: AEB41258
Position
257599..259449
Genome map
AA seq 616 aa AA seqDB search
MKQTLTKRILLFLFLVIPIPLILNLIVISYFSFSAAKTNCVQTLYSHATNLSIEFDKRLS
IHKLFIDRLANTLSLKTYASAVEGYTFAANELHVLPDTDVSLCLINVLDGSIHTKYPGDP
FIRYLKEHPELKKKLSANIGRALLLTIESSKPQHYLVLTEDITPWNSPQISGLLVGFYPM
AFLQKDLFQSLHITQGNIYLLNKYGETLFSSQPDEELPIFSLDLPNLPKISPKVSSSLKI
SAPPKVLREKNLVSITIKGKRYLGLLLNKIPIQGTYTLSLIPLRELIRESLTLPLNIFIF
YVLAFCLMGWIFSKINKKLNQPLQELTLCMESAWRGNHNVRFEPQPYGYEINELGNIFNC
THLLLLNSIEKADIEYAFGTRLQKELTILESLQNSLLSPAFPTFPGITFFLKHLQGKQLS
GHFYGWSPKDPHILLGVVGLAGDVGLPSYLYALSARSLFLAYATLYSSLTQVSEETTKSF
STTTEGNEASVSMTFLKYSSETQELSFLSTGGHAPTVFLKRKDTFSHLPSPSSLPILPGD
LLIFVTGSQALIQHLSTLPLEALLKDSLSPVNDDNFISSLVELLNSQNLTETEGTLTILK
FSLQAPMQNQVTERSL
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaaacactcacaaagcgtattcttctatttctatttttagtcattccgattcct
cttattctgaatcttatagtgattagctatttttccttttctgcagcaaaaaccaactgc
gtccaaacgttatactcccacgcgacaaacctcagcatagaattcgataaaagactgtcc
atccacaagctcttcatcgacagacttgccaacaccctatctttaaaaacctatgcctct
gcagttgaaggctacacctttgctgcaaatgaactccatgttcttccagatacggatgtt
tctctctgcctaattaacgtcttggatggttctatacacaccaaatatcctggagaccca
tttatccgttatcttaaggaacatcccgaactaaaaaagaaactcagcgcaaacataggc
cgagctcttcttctgactatcgaaagctccaaaccccaacactaccttgttctcactgaa
gatatcaccccgtggaactccccgcaaatttcaggccttcttgtaggattttaccctatg
gcattcttacaaaaagacctctttcaatccttgcatatcacccaggggaacatctactta
ctaaacaaatatggtgaaactctcttctcctcccaaccagacgaagagctccctattttt
tccttagatcttccgaacctcccaaagatctctccaaaggtttcttcttcattaaagatc
tctgctcctcctaaagttctacgagaaaagaaccttgtcagcatcaccataaaaggcaag
cgctacctagggctgctgctaaataagatcccgattcaagggacttacacgctctcttta
attccccttagggagctgattcgagaaagcctcaccctccctttaaatatcttcatattt
tatgttttagctttctgccttatggggtggatcttttccaaaattaacaagaagcttaac
cagcctctacaagagctcactctctgtatggagtctgcatggcgagggaaccacaatgtc
cgctttgaaccccaaccctacggatacgaaatcaacgaacttggcaatatctttaactgc
acccatctgctcttgctaaactctatagaaaaagctgatatcgaatatgctttcggaacg
cggctacaaaaagaactcaccattttagaatccctgcagaactctctgttaagccctgct
ttccctacctttccggggatcaccttcttcttaaaacaccttcagggaaaacaactttct
gggcacttttacggatggagccccaaagatccccatattctccttggtgtcgttggcctc
gcaggcgatgttggactcccctcctacctctatgccttatctgcccgcagtctctttctt
gcctatgctacgctttactcctcactgacacaggtcagcgaagaaactacaaagagcttc
tccacaacaacagaaggaaatgaagcttctgtctccatgacattcttaaaatactcctca
gaaactcaagagctctccttcctctctactggggggcatgctcctactgtatttctcaaa
cgcaaagataccttctcacatctcccctcaccaagctctctccccatacttccaggggat
ctcctaattttcgtcacgggaagccaagctctcatacaacatctctctacacttcctcta
gaagctctccttaaagattcgctctctcccgtaaacgatgacaacttcatttcctcttta
gtggaactcctaaactctcaaaaccttacggaaacagaaggcaccctgactatcctgaag
ttttcccttcaagcgcctatgcaaaaccaagtcactgagcgctctttatag

DBGET integrated database retrieval system