KEGG   Chlamydia pecorum E58: G5S_0246Help
Entry
G5S_0246          CDS       T01466                                 

Definition
(GenBank) hypothetical protein
Organism
cpm  Chlamydia pecorum E58
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NfeD IncA
Motif
Other DBs
NCBI-ProteinID: AEB41259
Position
complement(259430..259771)
Genome map
AA seq 113 aa AA seqDB search
MQVTSLISQGETSTCTERLLPYRTCLYTVSKVSFVLALGFAVASAFIAALSTVPTPIALI
ACASLSIGFLIISAVLALLLDFYFPLSQKALESKEEGTAPFKENELNSIKSAQ
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtgacatctttaatttctcagggagaaacgtctacatgtacagagaggcttctt
ccctatagaacgtgtttgtatacggtttctaaggtgagctttgttcttgccttaggtttt
gcggtagcctctgctttcattgcagcattatcaacagtccctaccccgatagcattgatt
gcctgtgcttctttatccatcggttttttgataatttctgcagtgcttgcgctattgttg
gatttttacttcccgctgtctcaaaaagctttagagtctaaggaagaaggaacagcgcct
ttcaaagagaacgagctaaattctataaagagcgctcagtga

DBGET integrated database retrieval system