KEGG   Chlamydia pecorum E58: G5S_0247Help
Entry
G5S_0247          CDS       T01466                                 

Definition
(GenBank) conserved hypothetical protein
Organism
cpm  Chlamydia pecorum E58
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SCAB_CC PA28_alpha Prp19 SKA2 RRF_GI
Motif
Other DBs
NCBI-ProteinID: AEB41260
Position
259884..262772
Genome map
AA seq 962 aa AA seqDB search
MPRLDESVFHSLTQEPQPHALEEIFCRDDEAGFEAYRTTALQSPLAAKTVRMARETARYI
LSDNGEIDSVRLVEAIEHLSHCLYPLGPYRHEETQIREHLLRMLKALKESSELKDRIKKL
FVPSYVSIQNLIRDTLALEETASISTFHVRQAVLAAMFSYLRQDVGSCFATAPAILIHQE
YPHRFLKDLEDLLSSGKLTRIIGSREVTIPINLSGCIGELFKRIRILDLHPDPIQTLSSS
PGLQKAFEAAGVLHSLEAPQIQVQKLLAHEYLLKKLSQEHDTISAHEILQSTLLNLYQLS
ETTVKATLCKEGMFSKNPALFLSQDPRELSQNQRVYGYLFAYKQARRAFIHDTQNPLLKS
WEYSLATLADANSSSTLNHIRISLGWNSNDSYSIATQMKQFIEQEIESLRSVVSKCEQTY
QEARSQLDYIENRLKNPLNTQDSQILTMDHIRFRQELNKALYDWDAAQEKVKKLLNLPDY
LLSFYAKAIPQYFRSAYDAYIQEFSHIHTDTPAGFRLLFTHGRAHPHAWSPVYSIEEFIR
FLSEFFSLTEVDLMGKHAIVDLEKETSSLIHHLISLLHTEHFQEAALTRILNTYNLPVPS
PLFDHLDTLVITPWVYISGGSVESLLTDYFELTTPITTIQKRPENAHELAAFFSDALKDL
PEGIKSYLEEGDHSLLTASPTHVFSLTAGSPLFREAWDNDWYSYTWLRDVWVKQHKTFLE
NTLLSQPEVYACLGSFCSKYSLNSLTQELYDFCAEPSQSLPELYEKSSRFLQGALQDAHS
LELYQRRLARHLVQEPPYVSEQQLPETLEMISSYLGISSRMAFPKFQELIERHIPKLSLL
SSSDLRHLYLGLLMQSYQKVYVEEDLYMRVASAMRHHKLAYPAPLLFGDSNWPYSYFGFL
LHPGTGHIDLWQCNYAGLKASPLENLQEILAVTRPWTLYANPIDYGMPPPPGYRSQMPKG
FF
NT seq 2889 nt NT seq  +upstreamnt  +downstreamnt
atgccacgattagatgaatctgtttttcattccttaacccaagagccgcagcctcatgcc
ttagaagagatcttttgtagggatgatgaagcaggattcgaggcgtatcgcacgacagcg
ttacagtctcctcttgcggcaaaaactgtccgcatggcaagggaaaccgcgcgttatatc
ctctccgacaatggggagatagatagcgtaaggcttgtagaagctatagaacatctctct
cattgtttatatcctttagggccatatcgccacgaagaaacacaaatccgagagcatctc
ctacgcatgctcaaggccctaaaggaatcttccgagctcaaagaccgcataaaaaagctt
tttgttccttcctatgtttctatccaaaatctcatccgcgatactctagctctagaagaa
actgcttctatatctacattccatgtccgacaagcggtgcttgcagcaatgttttcctac
ttacgtcaagatgtcggctcatgtttcgctacagcgccggctattcttattcatcaggaa
tatcctcaccgctttctcaaagaccttgaagacctacttagctctgggaagctcacgcga
atcatcggctcaagagaagttactattcctataaatctctcaggatgcattggagagcta
ttcaagcgcataagaattttagacctccatcccgatcctatacaaactctttcttcctct
ccagggttacagaaagcttttgaagctgcaggtgttcttcattccttagaggcccctcaa
atccaagtacaaaaactgctcgctcatgaatatctcctcaagaaactctcccaagagcat
gataccatttccgctcacgagatcctacagtccacgcttcttaacctctatcagctctct
gaaactacggtaaaagccactctctgcaaagagggcatgttcagcaaaaatcctgctctg
ttcctctcccaagatccccgagagctctcccaaaaccaaagggtatatggctacctcttt
gcctataaacaggcgaggagagcctttatccacgacacgcaaaatcccctgttgaaatct
tgggagtactccctagcaacacttgcagatgcaaactcctcctcaaccctaaaccacatc
cgcatctccttagggtggaacagcaacgattcctatagcattgctacacaaatgaaacag
tttatagaacaggaaattgaatcactccgttctgtagtgtctaagtgtgagcaaacctat
caagaagcgcgttcccagctggactatatcgaaaatcgcttgaaaaaccctctgaatacc
caagatagccagatccttactatggatcacatacgcttccgccaagagctaaataaagct
ctctatgattgggatgccgcccaagaaaaagtaaagaaactcttaaatctccctgactat
ctgctttctttttacgccaaagctatcccacaatacttccgcagtgcgtacgatgcttat
atccaagagttctcccatatccatacagatactcccgcgggattccggcttctttttacc
catggaagagcccatccccacgcatggtctccggtatactctatagaagaatttatccgc
tttctttcagaattcttctccttaacagaagtcgatctcatgggaaaacacgcaatcgtc
gatctcgaaaaagaaacctcttctcttattcatcatctcatttctctgttacacacagag
cactttcaagaggccgcacttactcgcatcctaaatacctacaaccttcctgtcccctcc
cccctctttgatcacttagacacgcttgtcatcaccccatgggtctacatttcaggaggc
tctgtagaatccctacttacggattactttgaacttacaactcccatcacgacaatacaa
aagcgccccgaaaatgctcatgagctcgctgcttttttctcagacgccctcaaagacctc
cccgaaggcataaaaagctatttagaagaaggggaccactccctcctgacagcctctcca
acacacgtattttccttaacagcaggctctcctttatttcgagaagcctgggataatgat
tggtacagctacacatggctacgagatgtctgggtaaagcagcacaagacttttttagaa
aacaccttactttcacaaccggaagtgtatgcctgtttagggagtttctgttcgaaatac
tctctaaattctctaactcaagaactatatgatttttgtgcagaaccctcccagtctctc
ccagagctttacgaaaaaagttctcgctttctacaaggagccctccaagatgcccattcc
ctagagctctaccaacgtaggctcgcgcgccacctcgttcaggaacccccctatgtctca
gaacaacagcttccagaaaccctagagatgatttcctcctacttgggaatttcctcccgc
atggcatttcctaaatttcaagagcttatagaacgccacatccccaaactctctctactg
tcctcttctgatctgcggcatctttacctaggcttgcttatgcaaagttaccaaaaggtc
tatgttgaggaagatctctatatgcgcgtagccagtgctatgagacatcataaacttgcc
taccctgcacctttgctcttcggtgatagcaattggccttacagctacttcggcttcctg
ctccatccgggaaccggtcatatcgacttatggcaatgtaactacgcagggctaaaagcc
tctcctttggaaaatctccaggaaattcttgctgtaactcgtccatggactctttatgcc
aaccctatagattacggcatgcctccccctccaggataccgcagccaaatgccaaaaggg
tttttctaa

DBGET integrated database retrieval system