KEGG   Chlamydia pecorum E58: G5S_0255Help
Entry
G5S_0255          CDS       T01466                                 

Gene name
tolQ
Definition
(GenBank) MotA/TolQ/ExbB proton channel family protein
  KO
K03562  biopolymer transport protein TolQ
Organism
cpm  Chlamydia pecorum E58
Pathway
cpm01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cpm00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cpm02000]
    G5S_0255 (tolQ)
Transporters [BR:cpm02000]
 Other Transporters
  Pores ion channels [TC:1]
   G5S_0255 (tolQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MotA_ExbB
Motif
Other DBs
NCBI-ProteinID: AEB41267
Position
269620..270318
Genome map
AA seq 232 aa AA seqDB search
MLRLAQNPIIQAYREADIFGKGIFFSLLLLSLCTWTVLHQKLAIQKKFLKSGKNLKEFLI
KNRHAPLSLDVTPEPSPFADLYFTIKRGTLELLDKNRQRAPDRGPVLAPEDISSLETLLG
AVMPKYRALLHKNNFIPATTISLAPFLGLLGTVWGILVAFSQISSGNAGNSMLMEGLATA
LGTTIAGLFVAIPSLIMFNYLKAYSSQLISEIEQTAYLLLNSIEVKYRQNSL
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgttacgacttgcgcaaaaccccatcattcaggcttacagggaagccgatatcttcggt
aagggaattttttttagcctcctccttctgtccctatgcacctggacagtactccaccaa
aaacttgccatacaaaaaaaatttttaaaatcagggaagaatcttaaagaattcttaata
aaaaatcggcatgcgcctttatctttagatgtcactccagagccaagtccttttgcggat
ttgtatttcacgatcaagaggggaactttggagcttttggataagaatcgccaacgcgct
cctgatcgtggtcccgtattggctcccgaagatatttcatctttagagacccttttaggg
gccgtgatgccaaaataccgcgcgcttttacataaaaataattttatccctgcaacaaca
attagtttggcgccatttttaggacttttagggacagtctggggaattctggtagcattt
tcgcaaattagctctgggaatgcaggaaactctatgctaatggagggactagcgacagct
ctaggcacaacgattgcggggctatttgttgcgatcccttcattaatcatgtttaactat
cttaaagcatactcttcccaactcatttcagaaattgagcagacggcgtacttgctatta
aattctatagaagtcaaatatcggcaaaatagtttatga

DBGET integrated database retrieval system