KEGG   Chlamydia pecorum E58: G5S_0288Help
Entry
G5S_0288          CDS       T01466                                 

Gene name
recD
Definition
(GenBank) exodeoxyribonuclease V, alpha subunit
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
cpm  Chlamydia pecorum E58
Pathway
cpm03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:cpm00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    G5S_0288 (recD)
Enzymes [BR:cpm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     G5S_0288 (recD)
DNA repair and recombination proteins [BR:cpm03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     G5S_0288 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 UvrD_C_2 Viral_helicase1 DUF2075 Helicase_RecD PIF1 PhoH AAA_22 UvrD-helicase AAA_11 IstB_IS21 ResIII DEAD AAA_25 T2SSE UvrD_C ATPase CbiA AAA AAA_33 DUF1246 RNA_helicase TrwB_AAD_bind
Motif
Other DBs
NCBI-ProteinID: AEB41297
Position
complement(297999..299525)
Genome map
AA seq 508 aa AA seqDB search
MIESSPKIPDVLKDLLQQHVVSPLDVVFARRHTPPNTEKAMLFLAASSALWRHGYPFLCL
LEDRLVPSVPGLSEQVFFQGFQEFSENSSEELFVVAEKKLYLRSLYETRKKLFQKLTRVS
LAQPMFPSLKHLPKELSQAQAHTLQQVSQRCFSIVCGGPGTGKTFLAIQLIVALINENPH
MRIIVVSPTGKVAAHFRKVLANYSLPDTAISVHTIHHFLQEYAHQQYSTMNVLIVDEGSM
VDFHLLHSLVQTLPGRYTPCGKVQSASMIIFGDKNQLPPIGIGAGNPLQDLIETFPESTM
HLEVSYRAKTQDIQEIAQAILSHQMVPFSPLPPFSVAIELFADAFQRALSRGVSLCVLSP
MRLGVWGYVNLNRFIHHELQKRNPLLPVPIIVSNRYETWGLCNGDTGVLSVQQQKLMFSQ
EIVIDAQAFSNYTYNYAMSVHKSQGSEYDEVLVVVPKGCEIFESSLLYTAVTRAKSKLSI
WADAETLTKIIKKPRKYSFQGLDKALKH
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgatagaatcttccccaaagatcccagatgttcttaaagatttgctacaacagcatgtc
gtttcccctttagatgttgtttttgcacgtagacacacccctccaaacactgaaaaagca
atgctatttttagcggcctcttcagctttatggcggcatggctatcccttcctctgtctt
ttagaagatcgcttggtgccctcagttcctggactctctgaacaagttttttttcaaggg
tttcaggagttttccgaaaactcttctgaggagttatttgttgttgctgaaaaaaagttg
tatttgcgctccctatatgagacgcgcaaaaaactttttcagaaacttaccagagtgtct
ttagcacaacctatgttcccgagcttaaaacacctccctaaagagctatctcaagcacaa
gcgcatacattgcagcaagtttctcaaagatgtttttctatagtttgtggggggcctggg
acgggaaagacgtttttagccatacagctgatagtagcattaattaatgagaatccccat
atgcgtattattgtggtttcccctacagggaaggttgcagcgcatttccgcaaggttctt
gctaactattctctaccggacacagccatttcggtccatacgatacatcattttttacaa
gaatatgcccatcaacaatacagcacaatgaatgttcttattgttgatgagggctccatg
gtagattttcacttgcttcatagtcttgtacaaactcttcctgggcgctataccccatgt
gggaaggtacaatccgcgagtatgatcatttttggagataaaaatcagcttccccccata
ggaattggtgcggggaatcccctacaagatttaattgagactttcccggaaagcacgatg
catcttgaagtctcttacagagcaaaaacccaagatatccaagagattgcccaagcgatc
ttgtcacaccagatggtccccttctctccccttcctcctttttccgtagctatagagctt
tttgcagacgcttttcaacgagcattatctagaggggtaagcttgtgtgtgttgtctcct
atgcgcttgggagtgtggggatatgtaaatttaaatcgttttattcatcatgaacttcaa
aaacgtaatcccctcttgcctgtcccaattatagtttccaaccgttatgaaacttgggga
ttatgtaatggagatacaggagttctttctgttcaacaacaaaagctcatgttctctcaa
gagatagttatagatgctcaggcattctctaactatacctataactatgccatgtccgtc
cataagagccagggaagcgaatacgatgaagttctcgttgtcgtgcctaagggatgtgaa
atcttcgaatcttctttgctctatactgctgtgacacgagcaaaaagtaaactctctatt
tgggctgatgctgaaacactaacgaaaatcataaaaaaaccccgaaagtatagctttcag
ggtttagataaagcattaaagcactga

DBGET integrated database retrieval system