KEGG   Chlamydia pecorum E58: G5S_0651Help
Entry
G5S_0651          CDS       T01466                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cpm  Chlamydia pecorum E58
Pathway
cpm00010  Glycolysis / Gluconeogenesis
cpm00051  Fructose and mannose metabolism
cpm01100  Metabolic pathways
cpm01110  Biosynthesis of secondary metabolites
cpm01120  Microbial metabolism in diverse environments
cpm01130  Biosynthesis of antibiotics
cpm01200  Carbon metabolism
cpm01230  Biosynthesis of amino acids
Module
cpm_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cpm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    G5S_0651 (tpiA)
   00051 Fructose and mannose metabolism
    G5S_0651 (tpiA)
   00562 Inositol phosphate metabolism
    G5S_0651 (tpiA)
Enzymes [BR:cpm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     G5S_0651 (tpiA)
Exosome [BR:cpm04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   G5S_0651 (tpiA)
  Exosomal proteins of bladder cancer cells
   G5S_0651 (tpiA)
  Exosomal proteins of melanoma cells
   G5S_0651 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AEB41608
Position
649565..650344
Genome map
AA seq 259 aa AA seqDB search
MVRERYVLGNWKMHKTCQSAEEYMTTLCPLLKKEEPPCHVGIAAPFTALQCCSLQIEKFH
STLKLGAQNVFQEPEGAFTGEISLAMLKEFYTSFVLLGHSERRQKFHEDNAIIAAKMQAV
ANSGLLPVLCIGESLETKEKGETYPYLEEQLMSGLEKFPKDAEVVLAYEPIWAIGTGRVA
EAGEVQEIHEFCRRILARIFSEEKATEISILYGGSVKADNAALFGKCHDVDGLLVGGASL
KPTEFFEVIKNFCSADSAC
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggttcgtgagcgctacgttttagggaattggaaaatgcataagacatgtcagagtgcg
gaagaatacatgacgactctttgtcctttattaaaaaaggaagagcctccttgtcatgtg
ggcatagctgcacctttcactgcactccaatgctgttctctgcaaatagaaaagtttcat
tctactcttaagttgggagctcaaaatgtttttcaagagccagaaggggcatttactgga
gagatttccctagccatgctaaaggagttttatacttcttttgtattgcttggccactcg
gagcgtcgacagaagtttcatgaagacaatgctattatcgctgccaaaatgcaggctgtt
gcgaactccgggcttcttcctgtattgtgtatcggagaaagtttggaaaccaaagaaaag
ggggagacatatccttatttggaagagcagctgatgtcaggattagaaaagttccccaaa
gatgctgaggttgtgcttgcatatgaacctatttgggcgatcggaacaggaagagttgct
gaagcaggtgaggtgcaggagattcatgagttttgtaggcgtatattagcaagaatcttt
tctgaggaaaaggctacagagatttcgattctttatgggggatccgtaaaagctgacaat
gccgcacttttcgggaaatgccatgatgttgatggtttgttggttggcggagcttcctta
aaacctacagagttttttgaggtgatcaaaaacttctgcagtgcagattctgcatgttga

DBGET integrated database retrieval system