KEGG   Chlamydia pneumoniae CWL029: CPn0306Help
Entry
CPn0306           CDS       T00021                                 

Gene name
pdhC
Definition
(RefSeq) pyruvate dehydrogenase complex dihydrolipoyllysine-residue acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cpn  Chlamydia pneumoniae CWL029
Pathway
cpn00010  Glycolysis / Gluconeogenesis
cpn00020  Citrate cycle (TCA cycle)
cpn00620  Pyruvate metabolism
cpn01100  Metabolic pathways
cpn01110  Biosynthesis of secondary metabolites
cpn01120  Microbial metabolism in diverse environments
cpn01130  Biosynthesis of antibiotics
cpn01200  Carbon metabolism
Module
cpn_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cpn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CPn0306 (pdhC)
   00020 Citrate cycle (TCA cycle)
    CPn0306 (pdhC)
   00620 Pyruvate metabolism
    CPn0306 (pdhC)
Enzymes [BR:cpn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CPn0306 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-GeneID: 894987
NCBI-ProteinID: NP_224511
UniProt: Q9Z8N2
Position
345145..346434
Genome map
AA seq 429 aa AA seqDB search
MISLLKMPKLSPTMEVGTIVKWHKKSNDQVSFGDVIVEISTDKAILEHTANEDGWIREIL
RHEGEKIVIGTPIAVLSTEANEPFNLEELLPKTEPSNLEASPKGSSEEVSPATTPQAASA
TFTAVTFKPEPPLSSPLVFKHVGTTNNLSPLARQLAKEKNIDVSSIQGSGPGGRIVKKDL
EKAPPKSIAGFGYPESPEVPPGSYHEENLSPIREVIAARLQAAKISIPHFYVRQQVYASP
LLNLLKELQAQGIKLSINDCIVRACALALKEFPSINSGFNSVDNKIVRFDTIDISIAVAI
PDGIITPIIRCADRKNLGMISAEIKSLALKARNQSLQDTEYKGGSFCVSNLGMTGITEFT
AIVNPPQAAILAVGSVTEQALVLDGEITIGSTCNLTLSVDHRVIDGYPAAMFMKRLQKIL
EAPAVLLLN
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
gtgatctccttattgaaaatgccaaagctttctccaactatggaagtgggcactatagtg
aaatggcataaaaaaagtaatgatcaggtcagttttggagacgtcattgtagagatctct
acagacaaagctattttagaacatacagcaaatgaagatggctggattcgtgaaatctta
cgtcatgaaggcgagaaaatcgttataggcacccctattgcggtactctctacagaagcc
aacgagccctttaatctagaagaacttcttcctaagacagaaccttctaaccttgaagca
tctccaaaaggttcttctgaagaggtctcgcctgcaacaactccacaagctgcctcagca
acattcacagcagtaacttttaagccagagccacctctctcctcgcctttagtcttcaaa
cacgtaggcactacgaataatctctctccattagctagacaactagcaaaagagaaaaac
atagatgtctcatcaattcaagggagtggtcctggaggacgtatagtaaaaaaagattta
gagaaagctcctcctaaaagcattgctggttttggctatcctgagtctcccgaagtgcct
ccaggttcctatcatgaggagaatctctctccgattcgggaagtgattgctgcacgccta
caagctgctaagatctctattcctcacttctatgtaaggcagcaggtctacgcctcacct
ctccttaatctgctcaaagaacttcaagctcagggaatcaaactctctattaacgattgc
attgtacgtgcctgtgctctggcgctcaaagagttcccttctatcaattcaggatttaac
agtgtcgataataaaatcgtccgttttgatactatcgatatctcgatagctgtggccatt
ccagatggaattattacgccaattatacgctgcgcagaccgtaaaaatctcggcatgatt
tcagcagaaattaagagcttagcgttaaaagcaagaaatcaatctcttcaagacactgaa
tacaaaggagggtccttctgtgtctctaacttaggaatgacaggaatcactgaatttaca
gcgattgtcaatcctcctcaagcggcgattcttgccgtaggaagtgttacagaacaagct
cttgttcttgacggagaaattactataggatctacctgcaatcttaccctatctgtagat
catagagtgattgatggttatcctgctgcgatgtttatgaaacgattacaaaagatctta
gaagctccggctgtcctactattaaactag

DBGET integrated database retrieval system