KEGG   Chlamydia pneumoniae CWL029: CPn0863Help
Entry
CPn0863           CDS       T00021                                 

Gene name
pgmA
Definition
(RefSeq) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cpn  Chlamydia pneumoniae CWL029
Pathway
cpn00010  Glycolysis / Gluconeogenesis
cpn00260  Glycine, serine and threonine metabolism
cpn00680  Methane metabolism
cpn01100  Metabolic pathways
cpn01110  Biosynthesis of secondary metabolites
cpn01120  Microbial metabolism in diverse environments
cpn01130  Biosynthesis of antibiotics
cpn01200  Carbon metabolism
cpn01230  Biosynthesis of amino acids
Module
cpn_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cpn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CPn0863 (pgmA)
  Energy metabolism
   00680 Methane metabolism
    CPn0863 (pgmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CPn0863 (pgmA)
Enzymes [BR:cpn01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     CPn0863 (pgmA)
Membrane trafficking [BR:cpn04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    CPn0863 (pgmA)
Exosome [BR:cpn04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   CPn0863 (pgmA)
  Exosomal proteins of melanoma cells
   CPn0863 (pgmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-GeneID: 895583
NCBI-ProteinID: NP_225058
UniProt: Q9Z743
Position
complement(980828..981514)
Genome map
AA seq 228 aa AA seqDB search
MALLILLRHGQSVWNEKNLFSGWVDIPLSQQGIEEAFSAGRAIQNLPIDCIFTSTLVRSL
MTALLAMTNHHSKKIPYIVHEDPKAKEMSRIYSAEEENNMIPLYQSSALNERMYGELQGK
NKKQTAEQFGEERVKLWRRSYKTAPPQGESLYDTKQRTLPYFEKNILPQLQNGKNVFVSA
HGNSLRSLIMDLEKLSEEEVLSLELPTGKPVVYQWKNHKIEKHPEFFG
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atggctcttcttattttattacgtcatggacaatctgtatggaatgaaaaaaatttattt
tctggatgggtagacattcctttaagccaacagggaattgaagaggctttttccgcagga
agagctattcaaaatttgcctatagactgcatctttacctctaccttagtacgtagtctg
atgaccgccttactcgccatgacaaatcatcactctaagaagatcccctatattgttcat
gaagatcccaaagcaaaagagatgtcgaggatctacagtgcggaagaagaaaacaatatg
attcctctctatcaatctagtgccctcaacgaaagaatgtacggcgaacttcaaggaaaa
aataaaaaacaaacagccgaacagttcggagaagagcgggtcaagctgtggaggcgcagc
tacaaaacagctcctcctcagggagaaagcctctatgatacgaaacaaaggaccttgcct
tactttgaaaaaaatattttgcctcaactgcaaaatggaaaaaacgtttttgtttctgcg
cacggaaattccttacgctctttgattatggatctagaaaaattaagtgaggaagaggta
ctatctttagaattaccgacgggaaaaccagttgtatatcaatggaaaaaccacaaaatc
gaaaagcacccagaattttttggttaa

DBGET integrated database retrieval system