KEGG   Chlamydia pneumoniae CWL029: CPn0888Help
Entry
CPn0888           CDS       T00021                                 

Gene name
hemG
Definition
(RefSeq) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
cpn  Chlamydia pneumoniae CWL029
Pathway
cpn00860  Porphyrin and chlorophyll metabolism
cpn01100  Metabolic pathways
cpn01110  Biosynthesis of secondary metabolites
Module
cpn_M00121  Heme biosynthesis, glutamate => heme
Brite
KEGG Orthology (KO) [BR:cpn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CPn0888 (hemG)
Enzymes [BR:cpn01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     CPn0888 (hemG)
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     CPn0888 (hemG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO Thi4 Pyr_redox_3 MCRA NAD_binding_9 Glyco_hydro_3 FAD_binding_2 DUF3622
Motif
Other DBs
NCBI-GeneID: 895679
NCBI-ProteinID: NP_225083
UniProt: A0A0F7WJY6
Position
complement(1014116..1015423)
Genome map
AA seq 435 aa AA seqDB search
MKRAIIIGAGISGLAAGWWLHKKFPQAEILVLDKEAYAGGFVRTESPQGFSFDLGPKGFL
TRGDGEYTLKLIHELGLQNSLIFSDRAAKNRFVYYRGKAHKISTWTLLRKGLLPSLIKDF
RAPCYTQDSSVQDFLKRHSSQNFTSYILDPLITAIRAGHSSILSTHMAFPELAKREASSG
SLLRSYLKNRSPKKSKTDRYLASLSPSMGTLITTIQEKLPATWKFSTSVTHIDCSPKEAC
VTTPSETFFADMVIYTGPLQQLPVLLPNYGIENLSKRVLPWNLSSISLGWHHANFSLPKG
YGMLFADELPLLGIVWNSQIFPQATPGKTVLSLLIEGKWRESEAHAFAIAALSEYLNINQ
KPDAFALFSSQDGMPQHAVGFLERKERILPHLPGNLKIVGQNIAGPGLNRCIASAYHAIC
DLHTEETLAQPQSSL
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
gtgaagagagcaatcattataggcgcaggaatttctggtcttgctgcaggttggtggctt
cataagaaattcccccaagcggaaatccttgttttagataaagaagcctacgcaggaggc
ttcgtccgcacggaatcccctcaagggttttcttttgacctcggacctaaaggattcctc
acccggggagacggagagtatactctaaaacttatccatgaacttggtctccaaaattcc
ttgatcttcagtgatcgtgcagcaaaaaaccgctttgtctactacagagggaaggcccat
aaaatatccacctggactctcctaagaaagggcctgcttccttctttaattaaggacttc
cgtgcaccttgctatactcaagatagttccgttcaggatttcttaaagcgacatagttca
caaaattttacaagctatatattagatccactaatcacagccatacgcgcaggccatagc
agcattctctccacacacatggcatttcctgaactagcaaagagagaagcttccagcggg
tctctattacgcagttatcttaaaaatagatcccccaaaaagtctaagaccgacagatat
cttgcatctctatctccttccatggggactttgattactactatccaagaaaaactcccc
gcaacatggaagttttctactagtgtgactcacatcgattgttcaccaaaagaagcttgt
gtaaccacaccttcagagacgttttttgccgatatggtaatttatacaggacctctccag
cagcttcctgtattgcttcctaactatggaattgaaaatttatctaaaagagttctccct
tggaatttatctagcatcagcttaggttggcatcacgccaacttttcgcttcccaaaggt
tatggcatgctatttgcagacgagcttcccctcttgggaatcgtttggaattctcaaatc
ttcccgcaagctacgccagggaaaacagtgctctcccttctcattgaaggcaaatggcgg
gaatcagaagctcatgcctttgcgatagcagctctctcagaatacctgaatatcaatcaa
aaaccagatgcttttgctttattttcatctcaggatggcatgccacaacatgctgttggc
tttctagaaaggaaagagcgtatcctacctcacttaccaggaaatttaaaaattgtaggt
caaaatattgcaggcccaggactgaatcgatgtatagcttctgcatatcatgctatctgt
gatttacacaccgaggaaacgctggcacaaccccagagttctctgtag

DBGET integrated database retrieval system