KEGG   Chlamydia pneumoniae CWL029: CPn0889Help
Entry
CPn0889           CDS       T00021                                 

Gene name
hemN_2
Definition
(RefSeq) coproporphyrinogen-III oxidase
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
cpn  Chlamydia pneumoniae CWL029
Pathway
cpn00860  Porphyrin and chlorophyll metabolism
cpn01100  Metabolic pathways
cpn01110  Biosynthesis of secondary metabolites
Module
cpn_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
Brite
KEGG Orthology (KO) [BR:cpn00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CPn0889 (hemN_2)
Enzymes [BR:cpn01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     CPn0889 (hemN_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM HemN_C
Motif
Other DBs
NCBI-GeneID: 895373
NCBI-ProteinID: NP_225084
UniProt: Q9Z717
Position
complement(1015459..1016835)
Genome map
AA seq 458 aa AA seqDB search
MFNVNFKFLEGLHQPAPRYTSYPTALEWEPSDAAPALLAFQRIRENPQPLSLYFHIPFCQ
SMCLYCGCSVVLNRREDIVEAYINTLIQEMKLVVETIGFRPQVSRIHFGGGTPSRLSREL
FTLLFDHIHKLFDLSHAEEIAIEVDPRSLRNDMEKADFFQNVGFNRVSLGVQDTQADVQE
AVRRRQSHEESLKAYEKFKELAFQSINIDLIYGLPKQTKESFSKTIQDILAMYPDRLALF
SFASVPWIKPHQKAMKASDMPSMEEKFAIYSQSRHLLTKAGYQAIGMDHFSLPHDPLTLA
FKNKTLIRNFQGYSLPPEEDLLGLGMTSTSFIRGIYLQNAKTLEEYHNTVLRGTFATVKS
KILTEDDRIRKWAIHKLMCTFTINKEEFFNLFGYEFDTYFIESRDRLISMETTGLIHNSP
GSLKVTPLGELFVRVIATAFDHYFLNKVSKKECFSASI
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgttcaacgtcaactttaaattcttagaaggacttcatcaacccgcgcccagatacaca
agctaccctacagctttagaatgggaaccttccgatgcggctccagctcttctagcgttc
caaagaattagagaaaatcctcagcctctctctctttattttcatatccccttctgccaa
tccatgtgtttgtattgcggttgttctgttgttttgaatcgtcgtgaagatattgtagaa
gcttatatcaacaccctaatccaagagatgaaacttgtcgttgagaccataggattccgg
cctcaggtatccaggattcattttggaggaggcacccctagcagactctccagggagttg
tttaccctgctttttgaccacatccataagctttttgatctttcacatgctgaagaaatt
gctattgaagtggatcctcgttctttaagaaacgacatggaaaaagcagatttctttcag
aacgtaggttttaatagggttagcttaggcgttcaagatacccaagctgatgttcaagaa
gctgtacgacgacgccaatcgcatgaggaatctttaaaggcatacgaaaaatttaaggaa
ctcgccttccaaagtatcaatatagacttaatttatggtcttcccaaacaaaccaaggag
tccttttctaaaacaattcaagatatcttagcgatgtatccagatcgtcttgctttattt
tcttttgcctcagttccatggatcaagccgcaccaaaaagccatgaaagcttcggatatg
ccttctatggaagagaaattcgcgatttattctcaatcccggcatttacttacaaaagca
ggatatcaggccatcggtatggatcatttctctcttccccatgatcctcttaccctcgct
ttcaaaaacaaaactctaatccgcaactttcaggggtattctctacccccagaagaagat
ctgctcgggttaggaatgacttctacaagcttcattcgtggaatttatctacaaaatgca
aaaacccttgaggaatatcacaatacggtgcttcgaggaacatttgccactgtgaaaagt
aaaattcttaccgaggatgatcggattagaaaatgggcaatccataagctgatgtgcacg
tttacgatcaataaggaagagtttttcaacctttttggatatgagtttgatacttatttt
atagaaagtcgtgatcgcttgataagtatggaaactacaggtctcatccataacagtcct
ggctctttgaaagtaactcctcttggagaattgtttgtcagagtcattgccacagctttc
gatcactattttctcaataaggtatctaaaaaagaatgtttctcagcttctatataa

DBGET integrated database retrieval system