KEGG   Coprothermobacter proteolyticus: COPRO5265_1565
Entry
COPRO5265_1565    CDS       T00773                                 

Name
(GenBank) formate acetyltransferase
  KO
K23121  trans-4-hydroxy-L-proline dehydratase [EC:4.2.1.172]
Organism
cpo  Coprothermobacter proteolyticus
Pathway
cpo00330  Arginine and proline metabolism
cpo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    COPRO5265_1565
Enzymes [BR:cpo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.172  trans-4-hydroxy-L-proline dehydratase
     COPRO5265_1565
SSDB
Motif
Pfam: PFL-like Gly_radical
Other DBs
NCBI-ProteinID: ACI17189
UniProt: B5Y6E3
Position
1385179..1387638
AA seq 819 aa
MTDSNNQPDADKTTLTIEQEIQKRREAVRPINERIARLREESVNAQVKISTERARLVTEF
YQSGVADNLSIPVQRAMAFKYLLEHCSLPVEEGQLIVGLRGTGPKEVPTYPEICAHSLED
LDILDTRENMPYHNTAEDKQLYESTILPFWQGKTIREKLFQRMPEEWLQCYEAGIWTEFM
EQRAPGHTAGGERIFQKGILDIKEEIKRRMAQLDKSDSAYEEKLEELKAMDIAADALLIY
AQRYAEKLEQLAQEETNVDRKAELLHMASICRKVPAHAPETFWEALQHYWFIHVGITYET
NPWDSFNPGRLDQHLRPFYEKEISEGTLTREKAKELLEAFWVKFNNQPAVPKVGVTAEES
FTYNDFTKINIGGLKVDGSDGTSDVSYLLLEVLDEMRTLQPNTAVLISNKTPDRLLRKAL
EVIGPGFGEPPLFNADGIIVKMLRQGKTLEDARTAGVSGCVETGSFGKESYILTGYFNLP
KILEITLNNGVDPITGKKIGLETGDPITFQTYEELWDAYLKQIKYFMDIKMKGNDIIEEL
YATELPVPFMSLWIEDCVKRAKDYNSGGARYNTQYVQLVGLGTVTLSLSSIKYHVFENHT
FTMEELLKALTNDFEGPYEMMRQVILTRTPKFGEDNDFADSIAKALVDETVWLIESYPPT
PVRKASRRAYWLPTTVHVYFGKVMEASPDGRKAGMPVSEGVSPVQGSDRKGIAAVFRSVS
KCDWDKTGGALLNQKLTPDIVEDPETLRKLGQLVRSFFNMGGHHVQFNVVSAELLREAQK
RPADFQDLMVRVAGYSDYFVNLPKGLQEEIIARTEHETV
NT seq 2460 nt   +upstreamnt  +downstreamnt
ttgacggattctaataatcaacctgatgccgacaagaccacattgaccatagagcaggaa
atccagaagcgcagagaagctgttaggcccataaatgagcgcatagctcggctcagagaa
gaaagtgtaaatgcccaagtaaagatttctacggagcgagcacggttagtcacagagttt
taccagagcggagtggcagacaacctgagcataccagtgcagcgagccatggcatttaag
tacttgctggagcactgcagtttaccggtggaagagggccaactcattgtaggcttaaga
ggaacaggccccaaagaggtgcccacttacccagagatatgtgctcattcactggaagat
ttggacatactagatacccgagaaaatatgccctaccacaacactgctgaagacaaacag
ctttatgaaagcaccatactgcctttttggcaaggtaaaaccatcagggaaaaactgttc
caacgcatgcccgaggagtggctacagtgctacgaagcgggtatttggacagagtttatg
gaacagcgcgcaccgggtcacactgctggtggcgagcgtatcttccaaaagggcattctg
gatattaaggaagaaataaaacggcgcatggcacagcttgacaagagcgattccgcatat
gaagaaaaactggaagagcttaaagccatggacattgcagctgatgcgctgcttatctat
gctcagcgttatgcagagaaattggaacaattagcacaagaagaaacgaatgtggatagg
aaagcagagcttttacatatggcttccatttgccgcaaagtacctgctcatgcgccagaa
accttctgggaggcacttcagcattactggttcatacacgtgggcataacttatgaaacc
aacccctgggattctttcaacccagggcggctggatcagcacttaaggcccttttatgag
aaagaaatcagtgaaggaacgttaactcgggaaaaagcaaaggaactgcttgaagctttt
tgggtgaagttcaacaaccagccagcagtacctaaggtgggcgtcacggctgaagaaagt
tttacctacaacgattttacaaaaataaacattggtggcttaaaggtggacggctcggac
ggcaccagcgatgtttcttacctgctactggaagtacttgatgaaatgcgcacactgcag
ccaaacacggcagttcttataagcaataaaacacctgatagactgctcaggaaagcacta
gaggttattggcccaggttttggtgaaccacccctgttcaacgctgatggcatcattgtg
aaaatgcttaggcaagggaaaaccttggaagatgcaaggactgcaggggtaagcggttgt
gtggagacaggttccttcggcaaagaatcctacatactgacagggtattttaacctgcca
aagatactggaaatcacccttaacaatggtgtggacccaataacgggcaagaaaataggt
ttggagacaggagaccctatcactttccaaacttatgaagaactttgggacgcctactta
aagcaaataaagtacttcatggacataaagatgaagggcaacgacattatcgaggaactt
tacgccactgagctgcctgtaccattcatgtcgctgtggattgaagattgcgtaaagcgt
gcaaaggattacaacagtggcggggctcgttacaacacgcagtatgtacagcttgttggt
ttgggcactgtaactttgagtctgagttccataaaataccacgtgtttgaaaaccacaca
ttcaccatggaagagctgctcaaagcactcacgaacgactttgaaggtccatatgagatg
atgaggcaggtcatacttacgcgcacccctaagtttggtgaagacaacgattttgccgac
agcatagcaaaagccttagtagatgaaacagtgtggctcattgagagttacccacctaca
ccagtaaggaaagcctctcgcagagcttattggttgcccactactgttcatgtgtacttc
ggcaaagttatggaagccagtccagacggaaggaaagctggtatgcccgtatccgaaggt
gtttcgccggtacagggtagtgacagaaaaggcatagccgccgtgttcaggtcggtgagc
aagtgcgattgggataaaacaggtggggcactgcttaaccagaagctcacgccagacata
gtggaagacccagaaacccttaggaagctgggacagctcgtaaggagctttttcaacatg
ggtgggcatcacgttcagttcaacgtagtcagtgcagaattgctccgtgaagcacagaag
aggcctgcagattttcaggacctcatggtccgcgttgctggttacagcgattactttgtg
aacctgccaaagggtttgcaggaggaaatcatagctcgaactgagcacgaaacggtgtaa

DBGET integrated database retrieval system