KEGG   Coprothermobacter proteolyticus: COPRO5265_0034Help
Entry
COPRO5265_0034    CDS       T00773                                 

Definition
(GenBank) tryptophan synthase subunit beta
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cpo  Coprothermobacter proteolyticus
Pathway
cpo00260  Glycine, serine and threonine metabolism
cpo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cpo01100  Metabolic pathways
cpo01110  Biosynthesis of secondary metabolites
cpo01130  Biosynthesis of antibiotics
cpo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cpo00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    COPRO5265_0034
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    COPRO5265_0034
Enzymes [BR:cpo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     COPRO5265_0034
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ACI17967
UniProt: B5Y6K9
Position
30731..31921
Genome map
AA seq 396 aa AA seqDB search
MITNKKAKFGEFGGQYVPEAVMQALIELENEFNRAKNDEQFLEEYHYYLREYDGRPTPLY
YAENLTRTLGGAKIYLKREDLNHTGAHKINNALGQVLLAKRMGKKRIIAETGAGQHGVAT
ATVAALFGMECEIFMGAEDVQRQRLNVFRMELLGAKVRSVTSGSSTLKDAVNEAIKDWVE
HIDSTFYLIGSAVGPHPYPLMVREFQKVIGEEAREQILQKEGRLPDYVLACVGGGSNAIG
IFYPFVQDTQVRLIGVEAAGKGLDTNKHAATFNRGTVGIIHGMKTYLLQSPDGEITEPYS
VAAGLDYPGVGPEHSYLKDIGRAKYESATDEEALAAFELLSRVEGIIPALESSHALAYAI
KLAPKLSKDQIIIVNLSGRGDKDVQQVAKMKGIEEI
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgattacaaataaaaaggcaaaattcggtgagtttggagggcaatacgtgcccgaggcc
gtaatgcaggcactcattgagctggaaaatgaattcaacagagcaaaaaatgatgagcag
ttcttggaagaataccactattacttacgtgaatatgatggacgtcccactccactttac
tatgcagaaaatctaaccagaacgttaggtggagccaagatttacctaaagagggaagac
ctgaaccacacgggcgctcacaaaatcaacaacgcattgggacaagttcttttagcaaaa
cgcatgggaaagaaacgcatcattgcggaaactggtgctgggcaacacggcgtcgccaca
gctactgtggcagcattgttcggcatggaatgtgaaatcttcatgggagcagaagacgtg
cagagacagcggttgaacgtttttcgcatggaacttcttggcgcaaaggtgagaagcgta
acctctgggagttccacccttaaagacgctgtgaacgaggccataaaggattgggtagaa
cacatcgatagcacattctaccttatcggttcagcagtaggaccacacccctacccactc
atggtcagggaatttcaaaaggttattggagaagaagctcgggaacaaatacttcaaaaa
gaagggcgccttccagactacgtgctggcttgcgtgggcggaggtagcaatgctattggc
attttctatccgttcgtgcaggacacccaagttaggctgattggtgtggaggcagcaggc
aaaggtcttgacactaacaagcacgcagccacattcaacagaggaaccgtgggtatcatt
catggcatgaaaacctatctattgcaaagccctgatggtgaaatcacagagccttactca
gtggcagcaggcctggattatccgggtgtgggacctgaacacagctacttaaaagacatc
ggcagagccaagtatgaaagtgccaccgacgaagaagcattggcagcctttgaacttcta
tcacgtgtagaaggcatcattcctgccttagaaagctcgcatgccttggcatacgctata
aaactggcgccaaagctgagcaaagatcagatcatcattgtgaacctatcaggcagagga
gacaaagacgtgcagcaagtggcaaaaatgaaaggcattgaagaaatttag

DBGET integrated database retrieval system