KEGG   Coprothermobacter proteolyticus: COPRO5265_0494Help
Entry
COPRO5265_0494    CDS       T00773                                 

Definition
(GenBank) glycyl-tRNA synthetase subunit beta
  KO
K01879  glycyl-tRNA synthetase beta chain [EC:6.1.1.14]
Organism
cpo  Coprothermobacter proteolyticus
Pathway
cpo00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:cpo00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    COPRO5265_0494
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cpo01007]
    COPRO5265_0494
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cpo03016]
    COPRO5265_0494
Enzymes [BR:cpo01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     COPRO5265_0494
Amino acid related enzymes [BR:cpo01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   COPRO5265_0494
Transfer RNA biogenesis [BR:cpo03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    COPRO5265_0494
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA_synt_2f DALR_1
Motif
Other DBs
NCBI-ProteinID: ACI17969
UniProt: B5Y7V6
Position
448530..450539
Genome map
AA seq 669 aa AA seqDB search
MDLLFELGFEEMPPSHLKALKQQVMERLEPTFKDYGLSFETVKTFLTPRRFALLLGGLPE
KQAVVEKMIKGPPKSACYMPDGSIKPALEKFMQSNGVSSDNIRIIEENGKSYVYAFKTEG
GKDACEVLPALLEDLFTDLWFPKSMRWGQGYVFGRPVRWIVALVDDQVLHIELFGVKSNR
VSRGLRVFGSDVEIDIPGHYEQLEKEKGLIIADENKRRDLIRNQAEKLAAELNGKPHLPE
ELLEELTFINEYPTGFVGHFEDRFLQLPKKVLETVMIHHQRYVAVENEQGQLLPYFIGFR
NGPSENIQQVIVGNERVIRARFYDALFFVEEDLKTPFADRVQGLERISFLGNYGTLLDKV
NRVKRLLALFNKENDLLLQSLAELYNADLTTLMVQELPELHGYMGTFYAKRSGVEEPLAN
LIEEVVTEPRVENSAIIKVLDALDTIFAGFDMGFVPSGSSDPMGLKGLAFDVLDLICKFF
PERSVKDLVLGAASILGKENLVAAVEEFFLDRLDSWIECKEIRVKNAIMDRALDKPIGMF
PIMVEVLGQFWTGTMVQNIALAHRRIRNIIRNQEAHASFDPAIGSENDLRLHESFLNNGI
RIDSLNVVTKDGLMKVLEYLTALSDDVHEYFDKELVMAEDVKVRQNRVALLMAVDNLFSR
FAYFGDLVL
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atggatctactttttgagttgggttttgaggaaatgccgccttctcatctgaaagctttg
aaacagcaggttatggagcgcttggagcccacttttaaggattatgggctctcttttgag
acggttaaaacatttcttacacccagacgttttgctttattgttgggcggtttgccagaa
aaacaagctgtggtggaaaaaatgataaaaggcccacctaaaagtgcttgttacatgcca
gatggcagcattaagcctgctttggaaaagttcatgcaatccaacggggttagctcagac
aatataagaataattgaagaaaacggtaagagttatgtctatgctttcaaaacagaaggt
ggtaaagatgcttgtgaggtcctcccagcattacttgaagatctattcacggacctttgg
tttcccaagagcatgcgttggggccaaggttatgtgtttggtcgacctgttcgctggatt
gtggctctagtcgatgatcaagtgctccacatagaacttttcggggtgaaatcgaaccgg
gtatcgcgtggacttagggttttcggtagtgatgtggaaatagacatccctggtcattat
gagcagctggaaaaggaaaaaggtttgatcatcgcagatgaaaacaaaagaagagatttg
atacgtaaccaagctgaaaagcttgctgcagagctaaatggcaagccgcacttacctgag
gaattattagaagaactcacctttattaacgaatacccaacggggtttgttgggcatttt
gaagataggttcttgcagcttcctaaaaaggtactggaaactgttatgatccatcaccag
cgctatgtggcggttgaaaatgaacagggtcagcttttgccttattttatcggctttaga
aatggccccagtgaaaacattcaacaggttattgtgggaaacgaaagagtgattcgtgct
aggttttacgatgcgctcttctttgtggaagaggacttgaaaacgccgtttgcagataga
gttcaggggcttgagagaattagttttttaggtaactacggaacgcttctggacaaagtt
aacagagtcaagcgtttgctggcactgttcaataaagagaatgatctgctacttcagagc
ttggctgaactttacaatgcagatctaactacgctcatggttcaggagctacctgagttg
catggatacatgggaacgttttacgctaagcgtagtggagtggaagaacctttagccaac
ctcattgaggaagttgttacagaaccaagggttgaaaatagcgcaatcataaaggtgctg
gatgcactggatactatttttgcgggtttcgacatgggctttgtgccttcaggttcctca
gatcccatggggctaaaaggcttggcatttgatgttttggatctcatctgcaagtttttc
cctgagcgatcagtgaaggatttagttttgggtgcggcaagcattttggggaaagaaaac
ctggttgctgccgtggaagaattcttcttggatcgcttagatagttggattgagtgcaag
gaaattagggttaagaacgctattatggacagggctctggataagcccataggtatgttc
ccaatcatggtagaagtgcttggacaattctggactggtaccatggtgcagaacattgcc
ctagctcacaggcgaattcgcaacataatcaggaatcaggaggctcatgcaagttttgat
ccggctatcgggtctgagaacgatttaagattgcacgagagttttcttaacaatggcata
agaatagactctttaaacgtggtaacaaaagatggtttaatgaaggtgctggaatactta
actgctctaagtgatgacgtacacgagtattttgacaaggaactggtaatggcagaagac
gttaaggtgcgtcagaacagggttgcattactcatggctgttgataatctgttcagcaga
tttgcatatttcggcgacttagttttgtag

DBGET integrated database retrieval system